BLAST/PSIBLAST alignment of GI: 254780269 and GI: 13470482 at iteration 1
>gi|13470482|ref|NP_102051.1| leucyl/phenylalanyl-tRNA--protein transferase [Mesorhizobium loti MAFF303099] Length = 205
>gi|33301322|sp|Q98NC4|LFTR_RHILO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase; AltName: Full=L/F-transferase; AltName: Full=Leucyltransferase; AltName: Full=Phenyalanyltransferase Length = 205
>gi|14021224|dbj|BAB47837.1| leucyl/phenylalanyl-tRNA-protein transferase [Mesorhizobium loti MAFF303099] Length = 205
 Score =  219 bits (558), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 132/178 (74%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  ++ W++P  RGIIPL+ FHTPK L+K IR+ L+DIR +  FE+ I  CA+K 
Sbjct: 27  MAESASDPEVFWVRPETRGIIPLDGFHTPKSLRKTIRKSLFDIRFDFDFEATIDGCAEKR 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           ++R +TWIN  I++AY+ L  MG+ H++EAW++D LVGGLYGVSLG VFFGESMFS   +
Sbjct: 87  EERRSTWINAPIREAYVQLHRMGHCHSVEAWREDQLVGGLYGVSLGRVFFGESMFSKETD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ LK R F LLD QF T HL++FGA+++   +Y K+L  ALK   I F
Sbjct: 147 ASKICLVHLVERLKARGFALLDTQFTTEHLKRFGAVDVPRGKYEKMLAEALKGEAIFF 204