BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780269|ref|YP_003064682.1|
leucyl/phenylalanyl-tRNA--protein transferase [Candidatus Liberibacter
asiaticus str. psy62]
         (179 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780269|ref|YP_003064682.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039946|gb|ACT56742.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 179

 Score =  374 bits (961), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT
Sbjct: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN
Sbjct: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL
Sbjct: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179


>gi|315122827|ref|YP_004063316.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496229|gb|ADR52828.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 181

 Score =  292 bits (748), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/178 (74%), Positives = 156/178 (87%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +S  I+WI+P++RGI+PLE FH  K LKK IRR +YDIRIN AFE VIS+CAQKT
Sbjct: 1   MANSDDSSKIAWIRPIKRGILPLENFHVSKSLKKIIRRGIYDIRINYAFEEVISSCAQKT 60

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           Q RP TWIN TIQK Y+DLF+MGYAH+IEAWK+  LVGGLYG+SLGA+FFGESMFS M+N
Sbjct: 61  QDRPNTWINPTIQKLYVDLFHMGYAHSIEAWKEKKLVGGLYGISLGAIFFGESMFSRMDN 120

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICLTHLV+HLKKRQFLLLD QFITNHLRQFG IEI+H +YA++L+NALKH E+SF
Sbjct: 121 ASKICLTHLVEHLKKRQFLLLDTQFITNHLRQFGTIEISHNKYARILQNALKHSEVSF 178


>gi|222085638|ref|YP_002544168.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium
           radiobacter K84]
 gi|254809111|sp|B9JDP1|LFTR_AGRRK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|221723086|gb|ACM26242.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium
           radiobacter K84]
          Length = 207

 Score =  223 bits (568), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 136/178 (76%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K IR++ +DIR NT F++VI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDAFHISKSLAKTIRQKPFDIRFNTDFDAVIAACAEQT 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  L ++G+AH++EAW  D+LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINKTIRALYSTLHHIGHAHSVEAWDGDMLVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L++R F LLD QF T HL+ FGAI++   +YA++LE A++ P +SF
Sbjct: 147 ASKICLVHLVERLRERSFTLLDTQFTTEHLKTFGAIDMPKDEYARMLEKAMESPNLSF 204


>gi|13470482|ref|NP_102051.1| leucyl/phenylalanyl-tRNA--protein transferase [Mesorhizobium loti
           MAFF303099]
 gi|33301322|sp|Q98NC4|LFTR_RHILO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|14021224|dbj|BAB47837.1| leucyl/phenylalanyl-tRNA-protein transferase [Mesorhizobium loti
           MAFF303099]
          Length = 205

 Score =  219 bits (558), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 132/178 (74%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  ++ W++P  RGIIPL+ FHTPK L+K IR+ L+DIR +  FE+ I  CA+K 
Sbjct: 27  MAESASDPEVFWVRPETRGIIPLDGFHTPKSLRKTIRKSLFDIRFDFDFEATIDGCAEKR 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           ++R +TWIN  I++AY+ L  MG+ H++EAW++D LVGGLYGVSLG VFFGESMFS   +
Sbjct: 87  EERRSTWINAPIREAYVQLHRMGHCHSVEAWREDQLVGGLYGVSLGRVFFGESMFSKETD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ LK R F LLD QF T HL++FGA+++   +Y K+L  ALK   I F
Sbjct: 147 ASKICLVHLVERLKARGFALLDTQFTTEHLKRFGAVDVPRGKYEKMLAEALKGEAIFF 204


>gi|209549134|ref|YP_002281051.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|226737713|sp|B5ZMK3|LFTR_RHILW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|209534890|gb|ACI54825.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 204

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 131/178 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR+ ++IR + AF+SVI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDHFHLSKSLAKTVRRKPFEIRFDHAFDSVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINKTIRSLYATLFDMGHAHTVEAWDGDKLVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L++R F LLD QF T HL+ FGAI++    YA +L  A++ P + F
Sbjct: 147 ASKICLVHLVERLRERGFTLLDTQFTTEHLKTFGAIDVAKADYAVMLAAAMQSPHLKF 204


>gi|325292688|ref|YP_004278552.1| leucyl/phenylalanyl-tRNA-protein transferase [Agrobacterium sp.
           H13-3]
 gi|325060541|gb|ADY64232.1| leucyl/phenylalanyl-tRNA-protein transferase [Agrobacterium sp.
           H13-3]
          Length = 204

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 130/178 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSA+  ++ W++P  RGIIPL  FH  K L K +R++ ++IR NTAFE+V++ CA + 
Sbjct: 27  MADSADDPELFWVEPEIRGIIPLNDFHISKSLAKAMRKKPFEIRFNTAFEAVMAGCAAEA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+K Y +L  +G+AH++EAW    LVGGLYGVSLGA FFGESMFS   N
Sbjct: 87  PDRPSTWINATIRKLYTELHQIGHAHSVEAWDGKELVGGLYGVSLGAAFFGESMFSRRTN 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L+   F+LLD QF T HL+ FGAI++   QYAK+L+ A+  P++ F
Sbjct: 147 ASKICLVHLVERLRASGFVLLDTQFTTEHLKTFGAIDVPKQQYAKMLDQAVNQPDLQF 204


>gi|150396173|ref|YP_001326640.1| leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium
           medicae WSM419]
 gi|166224674|sp|A6U825|LFTR_SINMW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|150027688|gb|ABR59805.1| Leucyltransferase [Sinorhizobium medicae WSM419]
          Length = 204

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 125/178 (70%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSA+  ++ W++P  RGIIPL+ FH  + L K IRR  +DIR +TAF  VI  CAQ+ 
Sbjct: 27  MADSADDPELFWVEPEIRGIIPLDRFHVSRSLAKVIRRRPFDIRFDTAFSEVIEGCAQRA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RPTTWIN TI+  Y  L  MG+AH++EAW+ D LVGGLYGVSLGA FFGESMFS   +
Sbjct: 87  PDRPTTWINDTIRALYAALHKMGHAHSVEAWEGDTLVGGLYGVSLGAAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L+ + F LLD QF T HL+ FGA+++  V+Y  LL  A+  P + F
Sbjct: 147 ASKICLVHLVQRLRSKGFQLLDTQFTTEHLKSFGAVDVPKVEYEVLLAKAIASPNLDF 204


>gi|15888654|ref|NP_354335.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium
           tumefaciens str. C58]
 gi|33301305|sp|Q8UFR8|LFTR_AGRT5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|15156384|gb|AAK87120.1| leucyl/phenylalanyl-tRNA-protein transferase [Agrobacterium
           tumefaciens str. C58]
          Length = 204

 Score =  217 bits (552), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 130/178 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSA+  ++ W++P  RGIIPL+ FH  K L K +R++ + IR NTAFE V++ CA + 
Sbjct: 27  MADSADDPELFWVEPEIRGIIPLDDFHVSKSLAKAMRKKPFAIRFNTAFEDVMAGCAAEA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI++ Y +L  +G+AH++EAW+ D LVGGLYGVSLGA FFGESMFS   N
Sbjct: 87  ADRPSTWINATIRRLYTELHQIGHAHSVEAWEGDELVGGLYGVSLGAAFFGESMFSRRTN 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L  + F+LLD QF T HL+ FGAI++  + YA++L+ A+  P + F
Sbjct: 147 ASKICLVHLVERLNAKGFVLLDTQFTTEHLKTFGAIDVPKLDYARMLDLAVNRPSLQF 204


>gi|15965071|ref|NP_385424.1| leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium
           meliloti 1021]
 gi|307301142|ref|ZP_07580911.1| leucyl/phenylalanyl-tRNA/protein transferase [Sinorhizobium
           meliloti BL225C]
 gi|307317875|ref|ZP_07597313.1| leucyl/phenylalanyl-tRNA/protein transferase [Sinorhizobium
           meliloti AK83]
 gi|33301319|sp|Q92QK2|LFTR_RHIME RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|15074250|emb|CAC45897.1| Leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium
           meliloti 1021]
 gi|306896637|gb|EFN27385.1| leucyl/phenylalanyl-tRNA/protein transferase [Sinorhizobium
           meliloti AK83]
 gi|306904097|gb|EFN34683.1| leucyl/phenylalanyl-tRNA/protein transferase [Sinorhizobium
           meliloti BL225C]
          Length = 204

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 122/178 (68%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSA+  ++ W++P  RGIIPL+ FH  + L K IRR  +DIR +TAF  V+  CAQ  
Sbjct: 27  MADSADDPELFWVEPEIRGIIPLDRFHVSRSLAKAIRRRPFDIRFDTAFAEVMEGCAQPA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RPTTWIN TI+  Y  L  MG+AH++EAW+ D LVGGLYGVSLGA FFGESMFS    
Sbjct: 87  PDRPTTWINDTIRSLYAALHNMGHAHSVEAWEGDALVGGLYGVSLGAAFFGESMFSRRTG 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L+ + F LLD QF T HL+ FGA+++   QY  LL  A+  P + F
Sbjct: 147 ASKICLVHLVERLRSKGFQLLDTQFTTEHLKSFGAVDVPKAQYEVLLAKAIASPNLEF 204


>gi|222148331|ref|YP_002549288.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium vitis
           S4]
 gi|254809112|sp|B9JVK2|LFTR_AGRVS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|221735319|gb|ACM36282.1| leucyl/phenylalanyl-tRNA--protein transferase [Agrobacterium vitis
           S4]
          Length = 212

 Score =  214 bits (545), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 96/179 (53%), Positives = 131/179 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S++  ++ W++P  RGIIPL++FH  K L K IR++ +DIR +TAF +V+  CA+  
Sbjct: 27  MAESSDDPELFWVEPDLRGIIPLDSFHYSKSLAKIIRQKPFDIRFDTAFAAVLDKCAEPA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AH++EA++ D LVGGLYGVSLGA FFGESMFS   N
Sbjct: 87  PDRPSTWINQTIRDLYTALFQMGHAHSVEAFEGDELVGGLYGVSLGAAFFGESMFSRRSN 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASKICL HLV+ L+ + F+LLD QF T HL+ FGAI++   +Y+K+LE A+    + FL
Sbjct: 147 ASKICLVHLVERLRAQGFVLLDTQFTTEHLKTFGAIDVAKDEYSKMLEEAVTMANVPFL 205


>gi|241204458|ref|YP_002975554.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858348|gb|ACS56015.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 204

 Score =  214 bits (545), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 130/178 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++P + FH  K L K +R++ ++IR + AF+ VI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPFDHFHVSKSLAKTVRKKPFEIRFDHAFDQVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  L+ MG+AHT+EAW+ D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINRTIRSLYSTLYDMGHAHTVEAWEDDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV  L++R F LLD QF T HL+ FGAI++    YA +L  A++ P ++F
Sbjct: 147 ASKICLVHLVDRLRERGFTLLDTQFTTEHLKTFGAIDVPKADYAAMLTAAMESPHLTF 204


>gi|86357494|ref|YP_469386.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium etli CFN
           42]
 gi|119367715|sp|Q2K927|LFTR_RHIEC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|86281596|gb|ABC90659.1| leucyltransferase protein [Rhizobium etli CFN 42]
          Length = 204

 Score =  214 bits (545), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 129/178 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR +  FE VI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDNFHISKSLAKRVRRRPFEIRFDHDFEQVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF +G+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINQTIRSLYATLFEIGHAHTVEAWDGDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L+++ F LLD QF T HL+ FGAI++   +YA LL  A++ P + F
Sbjct: 147 ASKICLVHLVERLREKGFTLLDTQFTTEHLKTFGAIDVPKAEYALLLAVAMESPHLKF 204


>gi|260460717|ref|ZP_05808967.1| leucyl/phenylalanyl-tRNA/protein transferase [Mesorhizobium
           opportunistum WSM2075]
 gi|259033294|gb|EEW34555.1| leucyl/phenylalanyl-tRNA/protein transferase [Mesorhizobium
           opportunistum WSM2075]
          Length = 205

 Score =  212 bits (540), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 129/178 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA   ++ W++P  RGIIPL  FHTPK L+K +R+ L+DIR +  FE+ I  CA+K 
Sbjct: 27  MAESAADPEVFWVRPETRGIIPLHGFHTPKSLRKTVRKNLFDIRFDFDFEATIDGCAEKR 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           ++R +TWIN  I++AY+ L  MG+ H++EAW+++ LVGGLYGVSLG VFFGESMFS   +
Sbjct: 87  EERRSTWINAPIREAYVQLHRMGHCHSVEAWREERLVGGLYGVSLGRVFFGESMFSKETD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK CL HLV+ LK R F LLD QF T HL++FGA+++   +Y K+L  ALK   + F
Sbjct: 147 ASKTCLVHLVERLKARGFALLDTQFTTEHLKRFGAVDVPRGKYEKMLAEALKGEAVFF 204


>gi|116251847|ref|YP_767685.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|119367716|sp|Q1MHI4|LFTR_RHIL3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|115256495|emb|CAK07579.1| putative leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 204

 Score =  212 bits (540), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 129/178 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++P + FH  K L K +R++ ++IR + AF+ VI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPFDHFHVSKSLAKTVRKKPFEIRFDHAFDQVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW+ + LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINRTIRSLYSTLFDMGHAHTVEAWEGNELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV  L++R F LLD QF T HL+ FGAI++    YA +L  A++ P + F
Sbjct: 147 ASKICLVHLVDRLRERGFTLLDTQFTTEHLKTFGAIDVPKADYAAMLTAAMESPHLKF 204


>gi|227821675|ref|YP_002825645.1| leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium fredii
           NGR234]
 gi|254809177|sp|C3MAB3|LFTR_RHISN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|227340674|gb|ACP24892.1| leucyl/phenylalanyl-tRNA--protein transferase [Sinorhizobium fredii
           NGR234]
          Length = 204

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 123/178 (69%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSAN  ++ W++P  RG++PL+ FH    L K IR+  Y+IR +TAFE+VI  CA+  
Sbjct: 27  MADSANDPELFWVEPEIRGVLPLDRFHVSHSLAKRIRKRPYEIRFDTAFEAVIEGCAKPA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RPTTWIN  I+  Y  L  MGYAH++EAW+ D LVGGLYGVSLGA FFGESMFS   +
Sbjct: 87  PGRPTTWINDKIRSLYAALHRMGYAHSVEAWEGDRLVGGLYGVSLGAAFFGESMFSLRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L+ R F LLD QF T HL+ FGA+++   +Y  LL  A+  P + F
Sbjct: 147 ASKICLVHLVERLRARHFQLLDTQFTTEHLKSFGAVDVPKAEYDLLLARAIASPNLEF 204


>gi|327193630|gb|EGE60513.1| leucyl/phenylalanyl-tRNA--protein transferase protein [Rhizobium
           etli CNPAF512]
          Length = 204

 Score =  211 bits (536), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 128/178 (71%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR + AFESVI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDHFHISKSLAKTVRRNAFEIRFDHAFESVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINQTIRSLYSTLFDMGHAHTVEAWDGDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+CL HLV  L+ + F LLD QF T HL+ FGAI++    YA LL  A++ P + F
Sbjct: 147 ASKVCLVHLVDRLRNKGFTLLDTQFTTEHLKTFGAIDVPKADYALLLAAAMESPHLKF 204


>gi|190891556|ref|YP_001978098.1| leucyl/phenylalanyl-tRNA--protein transferase protein [Rhizobium
           etli CIAT 652]
 gi|226737712|sp|B3PXY4|LFTR_RHIE6 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|190696835|gb|ACE90920.1| leucyl/phenylalanyl-tRNA--protein transferase protein [Rhizobium
           etli CIAT 652]
          Length = 204

 Score =  210 bits (534), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 128/178 (71%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR + AFESVI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDHFHISKSLAKTVRRNPFEIRFDHAFESVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINQTIRSLYSTLFDMGHAHTVEAWHGDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV  L+ + F LLD QF T HL+ FGAI++    YA LL  A++ P + F
Sbjct: 147 ASKICLVHLVDRLRNKGFTLLDTQFTTEHLKTFGAIDVPKADYALLLAAAMESPHLKF 204


>gi|218462711|ref|ZP_03502802.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium etli Kim
           5]
          Length = 204

 Score =  209 bits (532), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 128/178 (71%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR + AFE VI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPEMRGVLPLDRFHVSKSLAKTVRRHPFEIRFDHAFEQVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINQTIRSLYSTLFDMGHAHTVEAWHGDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV  L+++ F LLD QF T HL+ FGAI++    YA LL  A++ P + F
Sbjct: 147 ASKICLVHLVDRLRQKGFTLLDTQFTTEHLKTFGAIDVPKADYALLLAAAMESPHLKF 204


>gi|110634069|ref|YP_674277.1| leucyl/phenylalanyl-tRNA--protein transferase [Mesorhizobium sp.
           BNC1]
 gi|118572936|sp|Q11HL3|LFTR_MESSB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|110285053|gb|ABG63112.1| leucyl/phenylalanyl-tRNA--protein transferase [Chelativorans sp.
           BNC1]
          Length = 203

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 94/172 (54%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P  RGIIPL+ FH PK L+K +RR+ Y++R +T F  VI ACA+ +
Sbjct: 27  MAEHADDPEVFWVRPEMRGIIPLDKFHVPKSLRKLLRRQPYEVRYDTDFTGVIDACAEPS 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I+ AY +LF  G+ HT+EAW++  LVGGLYGVSLG  FFGESMFS   N
Sbjct: 87  AERAETWINEPIRVAYTELFKRGHCHTVEAWREGKLVGGLYGVSLGRAFFGESMFSREPN 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKICL HLV+ LK   FLLLD QF T+HLR+FGAI++   +Y ++L  AL+
Sbjct: 147 ASKICLVHLVERLKAGGFLLLDTQFTTDHLRRFGAIDVPRRRYEQMLAEALE 198


>gi|163759362|ref|ZP_02166448.1| putative leucyl/phenylalanyl-tRNA--protein transferase [Hoeflea
           phototrophica DFL-43]
 gi|162283766|gb|EDQ34051.1| putative leucyl/phenylalanyl-tRNA--protein transferase [Hoeflea
           phototrophica DFL-43]
          Length = 206

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 130/178 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSA+  ++ W++P  RG++P++ FH P+RL++ IR+  Y+IR+NTAF+ VI+ CA+  
Sbjct: 25  MADSADDPELFWVEPELRGVLPIDQFHVPRRLQRTIRQSPYEIRVNTAFDEVIARCAESV 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI + Y  L  +G+AH++EAW+ + LVGGLYGVSL   FFGESMFS   +
Sbjct: 85  ANRPSTWINSTITELYGSLHRLGHAHSVEAWQGEKLVGGLYGVSLRRAFFGESMFSRATD 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASKICL HLV+ L+ R F+LLD QF T HL++FG I++   +YA +L  AL+  +I F
Sbjct: 145 ASKICLVHLVERLRMRGFVLLDTQFTTEHLQRFGVIDVPREEYAVMLAKALEGEDIVF 202


>gi|153009605|ref|YP_001370820.1| leucyl/phenylalanyl-tRNA--protein transferase [Ochrobactrum
           anthropi ATCC 49188]
 gi|166224666|sp|A6X187|LFTR_OCHA4 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|151561493|gb|ABS14991.1| Leucyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 204

 Score =  207 bits (528), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 126/171 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P RRG+IPL+ FH PK L+K IR+ ++DI+++  F+ VI  CA  T
Sbjct: 28  MAEEADDPEVFWVRPERRGVIPLDGFHMPKSLQKTIRQGIFDIKLDNDFDGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY +LF +G+ HT+EAW    LVGGLYGV+LG  FFGESMF+   +
Sbjct: 88  GERARTWINGPIREAYKNLFEIGHCHTVEAWHDGQLVGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+CL +LV+HL K+ F+LLD QF T HL +FGA+E+   +Y KLLENAL
Sbjct: 148 ASKVCLAYLVQHLVKQGFVLLDTQFTTPHLERFGAVEVPRKKYEKLLENAL 198


>gi|239831782|ref|ZP_04680111.1| leucyl/phenylalanyl-tRNA--protein transferase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824049|gb|EEQ95617.1| leucyl/phenylalanyl-tRNA--protein transferase [Ochrobactrum
           intermedium LMG 3301]
          Length = 222

 Score =  204 bits (519), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 90/171 (52%), Positives = 124/171 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P RRG+IPL+ FH PK L+K IR+ ++DI++++ F+ VI  CA  T
Sbjct: 46  MAEEAHDPEVFWVRPERRGVIPLDGFHIPKSLQKTIRQGIFDIKLDSDFDGVIEGCASGT 105

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW    LVGGLYGV+LG  FFGESMF+   +
Sbjct: 106 GERARTWINGPIREAYRKLFEIGHCHTVEAWHDGKLVGGLYGVTLGRAFFGESMFTRKRD 165

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+CL +LV+HL  R F+LLD QF T HL +FGA+E+   +Y KLLE AL
Sbjct: 166 ASKVCLAYLVQHLVSRGFVLLDTQFTTPHLERFGAVEVPRKKYEKLLETAL 216


>gi|319783250|ref|YP_004142726.1| leucyl/phenylalanyl-tRNA/protein transferase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169138|gb|ADV12676.1| leucyl/phenylalanyl-tRNA/protein transferase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 205

 Score =  204 bits (518), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (73%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA   ++ W++P  RGIIPL+ FHTPK L K I++  +DIR +  FE+ I  CA+K 
Sbjct: 27  MAESAGDPEVFWVRPETRGIIPLDGFHTPKSLWKTIKKHPFDIRFDFDFEATIDGCAEKR 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R +TWIN  I++AYI+L  +G+ H++EAW++D LVGGLYGVSLG VFFGESMF+   +
Sbjct: 87  AERRSTWINAPIREAYIELHRIGHCHSVEAWREDRLVGGLYGVSLGRVFFGESMFARETD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK CL +LV+ LK R F LLD QF T HL++FGA+++   +Y K+L +ALK
Sbjct: 147 ASKTCLFYLVERLKARGFALLDTQFTTEHLKRFGAVDMPRGKYEKMLADALK 198


>gi|304391689|ref|ZP_07373631.1| leucyl/phenylalanyl-tRNA--protein transferase [Ahrensia sp. R2A130]
 gi|303295918|gb|EFL90276.1| leucyl/phenylalanyl-tRNA--protein transferase [Ahrensia sp. R2A130]
          Length = 204

 Score =  201 bits (512), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (69%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSA+   + W++P  RG+IPL+ FHTPKRL + IR+E +D+RI+TAFE  +  CA++ 
Sbjct: 27  MADSADDPGLFWVEPDYRGVIPLDGFHTPKRLARTIRQEKFDLRISTAFERTVDLCAEEA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y +L  MG+AH++E+W    LVGGLYGVSLG  FFGESMFS   +
Sbjct: 87  PDRKETWINQRIRQLYSELHLMGHAHSVESWLDGELVGGLYGVSLGGAFFGESMFSRTRD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L   +F+LLD QF T HL QFGA+EI    Y KLL +AL 
Sbjct: 147 ASKVALAHLVDRLNFNRFVLLDTQFNTEHLSQFGALEIPKRDYLKLLSDALD 198


>gi|209964252|ref|YP_002297167.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Rhodospirillum centenum SW]
 gi|209957718|gb|ACI98354.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Rhodospirillum centenum SW]
          Length = 216

 Score =  201 bits (511), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 88/174 (50%), Positives = 118/174 (67%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA S ++ W  P  RGI+PL+ FH P+RL++ IR++ + +R ++AF  V+ ACA+  
Sbjct: 19  MAESAASDELMWFDPPMRGIMPLDGFHVPRRLRRTIRQQPFTVRCDSAFRGVMEACAESG 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I  AY  L  +G+AH++E W  D LVGGLYGV+LGA FFGESMFS   +
Sbjct: 79  PGRPQTWINGDILDAYCRLHALGFAHSVECWAGDRLVGGLYGVALGAAFFGESMFSRATD 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV  L+   + LLD QF+T HL QFG++EI   +Y  LL  AL+ P
Sbjct: 139 ASKVALVHLVARLRAGGYTLLDTQFVTEHLAQFGSVEIPRARYKALLTEALRRP 192


>gi|328543661|ref|YP_004303770.1| Leucyl/phenylalanyl-tRNA--protein transferase [Polymorphum gilvum
           SL003B-26A1]
 gi|326413405|gb|ADZ70468.1| Leucyl/phenylalanyl-tRNA--protein transferase [Polymorphum gilvum
           SL003B-26A1]
          Length = 234

 Score =  201 bits (510), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 121/172 (70%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + WI+P +RGI+PL+ FH PKRL++ +R + ++IRI+T F++V+  CA   
Sbjct: 28  MAESADDPGLFWIEPEQRGILPLDGFHLPKRLRRTVRADDFEIRIDTDFQAVVDGCAAPA 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y +L+ +GY HT+EAW+   LVGGLYGVSL   FFGESMF+H  +
Sbjct: 88  PGRRKTWINRQIRRLYGELYDLGYCHTVEAWRDGRLVGGLYGVSLAGAFFGESMFTHERD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CLTHLV  L    + LLD QF+T HL +FG IE+    Y +LL +ALK
Sbjct: 148 ASKVCLTHLVARLIAGGYTLLDTQFVTEHLSRFGTIEVPKAAYDRLLRDALK 199


>gi|306843803|ref|ZP_07476401.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. BO1]
 gi|306275881|gb|EFM57597.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. BO1]
          Length = 204

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 28  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 88  GERARTWINEPIRRAYAKLFEIGHCHTVEAWHEGKLAGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 148 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 199


>gi|306840399|ref|ZP_07473164.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. BO2]
 gi|306289637|gb|EFM60841.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. BO2]
          Length = 204

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 28  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 88  GERARTWINEPIRRAYAKLFEIGHCHTVEAWHEGKLAGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 148 ASKVCLAYLVQHLARQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 199


>gi|17987347|ref|NP_539981.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           bv. 1 str. 16M]
 gi|225852417|ref|YP_002732650.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           ATCC 23457]
 gi|254693637|ref|ZP_05155465.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus bv.
           3 str. Tulya]
 gi|254701669|ref|ZP_05163497.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella suis bv. 5
           str. 513]
 gi|254706886|ref|ZP_05168714.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella
           pinnipedialis M163/99/10]
 gi|254714007|ref|ZP_05175818.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella ceti
           M644/93/1]
 gi|254716934|ref|ZP_05178745.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella ceti
           M13/05/1]
 gi|254719008|ref|ZP_05180819.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. 83/13]
 gi|256044578|ref|ZP_05447482.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256061010|ref|ZP_05451167.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella neotomae
           5K33]
 gi|256113451|ref|ZP_05454292.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159626|ref|ZP_05457388.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella ceti
           M490/95/1]
 gi|256254906|ref|ZP_05460442.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella ceti B1/94]
 gi|256264085|ref|ZP_05466617.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260563929|ref|ZP_05834415.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 1 str. 16M]
 gi|261213903|ref|ZP_05928184.1| phenyalanyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|261218740|ref|ZP_05933021.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti
           M13/05/1]
 gi|261222088|ref|ZP_05936369.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti B1/94]
 gi|261314351|ref|ZP_05953548.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261321761|ref|ZP_05960958.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti
           M644/93/1]
 gi|261325010|ref|ZP_05964207.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella neotomae
           5K33]
 gi|261752221|ref|ZP_05995930.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella suis bv. 5
           str. 513]
 gi|265983998|ref|ZP_06096733.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella sp. 83/13]
 gi|265991002|ref|ZP_06103559.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265994839|ref|ZP_06107396.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 3 str. Ether]
 gi|265998053|ref|ZP_06110610.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti
           M490/95/1]
 gi|306840105|ref|ZP_07472891.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. NF
           2653]
 gi|61227675|sp|P0A4S7|LFTR_BRUME RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|61227677|sp|P0A4S8|LFTR_BRUSU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|254809114|sp|C0RIN8|LFTR_BRUMB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|17983031|gb|AAL52245.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           bv. 1 str. 16M]
 gi|225640782|gb|ACO00696.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           ATCC 23457]
 gi|260153945|gb|EEW89037.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260915510|gb|EEX82371.1| phenyalanyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|260920672|gb|EEX87325.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti B1/94]
 gi|260923829|gb|EEX90397.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti
           M13/05/1]
 gi|261294451|gb|EEX97947.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti
           M644/93/1]
 gi|261300990|gb|EEY04487.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella neotomae
           5K33]
 gi|261303377|gb|EEY06874.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261741974|gb|EEY29900.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella suis bv. 5
           str. 513]
 gi|262552521|gb|EEZ08511.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella ceti
           M490/95/1]
 gi|262765952|gb|EEZ11741.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 3 str. Ether]
 gi|263001786|gb|EEZ14361.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263094289|gb|EEZ18150.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264662590|gb|EEZ32851.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella sp. 83/13]
 gi|306404833|gb|EFM61126.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. NF
           2653]
 gi|326408926|gb|ADZ65991.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           M28]
 gi|326538642|gb|ADZ86857.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           M5-90]
          Length = 204

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 28  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 88  GERARTWINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 148 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 199


>gi|254704212|ref|ZP_05166040.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella suis bv. 3
           str. 686]
 gi|260566540|ref|ZP_05837010.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella suis bv. 4
           str. 40]
 gi|261754880|ref|ZP_05998589.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella suis bv. 3
           str. 686]
 gi|260156058|gb|EEW91138.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella suis bv. 4
           str. 40]
 gi|261744633|gb|EEY32559.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella suis bv. 3
           str. 686]
          Length = 189

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 13  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 72

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 73  GERARTWINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 132

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 133 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 184


>gi|23501791|ref|NP_697918.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella suis 1330]
 gi|161618863|ref|YP_001592750.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella canis ATCC
           23365]
 gi|256369333|ref|YP_003106841.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella microti CCM
           4915]
 gi|23347722|gb|AAN29833.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella suis 1330]
 gi|161335674|gb|ABX61979.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella canis ATCC
           23365]
 gi|255999493|gb|ACU47892.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella microti CCM
           4915]
          Length = 177

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 1   MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 60

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 61  GERARTWINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 120

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 121 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 172


>gi|254710006|ref|ZP_05171817.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella
           pinnipedialis B2/94]
 gi|256031501|ref|ZP_05445115.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella
           pinnipedialis M292/94/1]
 gi|261317554|ref|ZP_05956751.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella
           pinnipedialis B2/94]
 gi|265988588|ref|ZP_06101145.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella
           pinnipedialis M292/94/1]
 gi|261296777|gb|EEY00274.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella
           pinnipedialis B2/94]
 gi|264660785|gb|EEZ31046.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella
           pinnipedialis M292/94/1]
          Length = 189

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 125/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 13  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 72

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 73  GERARTWINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 132

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 133 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 184


>gi|62289848|ref|YP_221641.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus bv.
           1 str. 9-941]
 gi|189024090|ref|YP_001934858.1| Aat, leucyl/phenylalanyl-tRNA--protein transferase [Brucella
           abortus S19]
 gi|237815336|ref|ZP_04594334.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus
           str. 2308 A]
 gi|254689154|ref|ZP_05152408.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus bv.
           6 str. 870]
 gi|254697289|ref|ZP_05159117.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254730187|ref|ZP_05188765.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus bv.
           4 str. 292]
 gi|256257404|ref|ZP_05462940.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus bv.
           9 str. C68]
 gi|260545405|ref|ZP_05821146.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella abortus NCTC
           8038]
 gi|260754653|ref|ZP_05867001.1| phenyalanyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260757876|ref|ZP_05870224.1| phenyalanyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260761699|ref|ZP_05874042.1| phenyalanyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883679|ref|ZP_05895293.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella abortus bv.
           9 str. C68]
 gi|297248253|ref|ZP_06931971.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella abortus bv.
           5 str. B3196]
 gi|75496900|sp|Q57DK4|LFTR_BRUAB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|118572930|sp|Q2YNP4|LFTR_BRUA2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226736111|sp|B2S5D7|LFTR_BRUA1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|62195980|gb|AAX74280.1| Aat, leucyl/phenylalanyl-tRNA--protein transferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|189019662|gb|ACD72384.1| Aat, leucyl/phenylalanyl-tRNA--protein transferase [Brucella
           abortus S19]
 gi|237790173|gb|EEP64383.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella abortus
           str. 2308 A]
 gi|260096812|gb|EEW80687.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella abortus NCTC
           8038]
 gi|260668194|gb|EEX55134.1| phenyalanyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672131|gb|EEX58952.1| phenyalanyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674761|gb|EEX61582.1| phenyalanyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260873207|gb|EEX80276.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella abortus bv.
           9 str. C68]
 gi|297175422|gb|EFH34769.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella abortus bv.
           5 str. B3196]
          Length = 204

 Score =  197 bits (502), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 124/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ ++ IR+++ F  VI  CA  T
Sbjct: 28  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFKIRLDSNFAGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 88  GERARTWINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 148 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 199


>gi|82699774|ref|YP_414348.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           biovar Abortus 2308]
 gi|82615875|emb|CAJ10879.1| Leucyl/phenylalanyl-tRNA--protein transferase [Brucella melitensis
           biovar Abortus 2308]
          Length = 177

 Score =  197 bits (501), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 124/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ ++ IR+++ F  VI  CA  T
Sbjct: 1   MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFKIRLDSNFAGVIEGCASGT 60

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 61  GERARTWINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 120

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 121 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 172


>gi|158422833|ref|YP_001524125.1| leucyl/phenylalanyl-tRNA--protein transferase [Azorhizobium
           caulinodans ORS 571]
 gi|158329722|dbj|BAF87207.1| leucyl/phenylalanyl-tRNA--protein transferase [Azorhizobium
           caulinodans ORS 571]
          Length = 232

 Score =  197 bits (500), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 118/171 (69%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + WI+P RRGIIPL+ FH P RL + IR++ ++IRI+T FE VIS CA   
Sbjct: 34  MAESADDPGLYWIEPDRRGIIPLDGFHIPSRLARTIRQDKFEIRIDTDFEGVISGCATPQ 93

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           + R  TWIN  I++ Y +LF  G  HT+EAW+   LVGGLYGV LGA FFGESMF +  +
Sbjct: 94  EGREKTWINPRIRRLYGELFDRGQCHTVEAWRDGKLVGGLYGVELGAAFFGESMFHYERD 153

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  LK   F LLD QFIT HL  FGA+E+T   Y +LLE ++
Sbjct: 154 ASKVALAHLVARLKVGGFKLLDTQFITGHLSGFGALEVTRRHYHRLLEESV 204


>gi|288959218|ref|YP_003449559.1| leucyl/phenylalanyl-tRNA--protein transferase [Azospirillum sp.
           B510]
 gi|288911526|dbj|BAI73015.1| leucyl/phenylalanyl-tRNA--protein transferase [Azospirillum sp.
           B510]
          Length = 217

 Score =  196 bits (499), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 119/173 (68%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA S+++ W  P RRGI+PL+ FH  + L+K +RR  +++R ++AF +VI  CA+ T
Sbjct: 20  MAESAESRELHWFDPERRGILPLDGFHVSRSLRKTLRRRPFELRFDSAFRAVIEGCAEAT 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           ++RP TWIN  I + Y DLF  G+AH++E W+   LVGGLYGVS+G  +FGESMFS    
Sbjct: 80  EERPKTWINDDIIRLYGDLFDSGFAHSVECWRDGRLVGGLYGVSIGGAYFGESMFSRETG 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           ASK+ L HLV  L+   F LLD QF+T HL +FGA+EI   +Y + L  A++ 
Sbjct: 140 ASKVALVHLVARLRAAGFALLDTQFVTEHLSRFGAVEIPRTEYRRRLAAAMER 192


>gi|83311839|ref|YP_422103.1| leucyl/phenylalanyl-tRNA--protein transferase [Magnetospirillum
           magneticum AMB-1]
 gi|119367700|sp|Q2W3N1|LFTR_MAGMM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|82946680|dbj|BAE51544.1| Leu/Phe-tRNA-protein transferase [Magnetospirillum magneticum
           AMB-1]
          Length = 209

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/171 (50%), Positives = 117/171 (68%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA S +   + W+ P +RGI+PLE FH PK L++ +R E +DIR +TAFE+V+ AC + T
Sbjct: 20  MARSRDENRLYWVDPEQRGILPLEAFHVPKSLRRTLRSERFDIRCDTAFEAVMRACGEAT 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I + +++LF +G  H++E W+   LVGGLYG++LGA FFGESMFS   +
Sbjct: 80  ADRPETWINEQIIRLFVELFELGLGHSVEVWQDGELVGGLYGLALGAAFFGESMFSRRTD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   F LLD QF+T HL+QFGA EI+   Y   L +AL
Sbjct: 140 ASKVALVHLVARLRHGGFRLLDTQFVTEHLKQFGAQEISRAAYQDRLADAL 190


>gi|294852260|ref|ZP_06792933.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella sp. NVSL
           07-0026]
 gi|294820849|gb|EFG37848.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella sp. NVSL
           07-0026]
          Length = 204

 Score =  194 bits (494), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 124/172 (72%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W++P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 28  MAEEADDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R  T IN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 88  GERARTCINEPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 148 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 199


>gi|254469283|ref|ZP_05082688.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudovibrio sp.
           JE062]
 gi|211961118|gb|EEA96313.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudovibrio sp.
           JE062]
          Length = 229

 Score =  194 bits (493), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (68%), Gaps = 1/172 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++A+S D+ WI P RRGI+PL++FH PKRL + +R + + +R +  F++VIS CA   
Sbjct: 21  MAETADSPDLFWIDPERRGILPLDSFHIPKRLARTVRADKFIVRASRNFKAVISHCATTN 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME 119
            +R  TWIN  I+K Y +LF MGY HT+E +   D LVGGLYGVSLG  FFGESMFS   
Sbjct: 81  AERKETWINAEIRKLYTELFAMGYCHTVEVYNTSDELVGGLYGVSLGGAFFGESMFSLER 140

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           +ASK+ L HL   L    + LLD QF+T HL QFGA E+   QY KLLENAL
Sbjct: 141 DASKVALVHLYGRLLYGNYRLLDAQFVTEHLEQFGATEVPKEQYGKLLENAL 192


>gi|225627394|ref|ZP_03785431.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella ceti str.
           Cudo]
 gi|260168634|ref|ZP_05755445.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella sp. F5/99]
 gi|261758107|ref|ZP_06001816.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella sp. F5/99]
 gi|225617399|gb|EEH14444.1| leucyl/phenylalanyl-tRNA--protein transferase [Brucella ceti str.
           Cudo]
 gi|261738091|gb|EEY26087.1| leucyl/phenylalanyl-tRNA-protein transferase [Brucella sp. F5/99]
          Length = 204

 Score =  194 bits (492), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 123/172 (71%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+  ++ W+ P +RG+IPL+ FH P+ L+K IR+ +++IR+++ F  VI  CA  T
Sbjct: 28  MAEEADDPEVFWVHPEKRGVIPLDGFHIPRSLQKTIRQGIFEIRLDSNFAGVIEGCASGT 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +   TWIN  I++AY  LF +G+ HT+EAW +  L GGLYGV+LG  FFGESMF+   +
Sbjct: 88  GECARTWINKPIRRAYAKLFEIGHCHTVEAWYEGKLAGGLYGVTLGRAFFGESMFTRKRD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL +LV+HL ++ F+LLD QF T HL +FGA+E+   +Y ++LE AL+
Sbjct: 148 ASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALE 199


>gi|254500505|ref|ZP_05112656.1| leucyl/phenylalanyl-tRNA--protein transferase [Labrenzia alexandrii
           DFL-11]
 gi|222436576|gb|EEE43255.1| leucyl/phenylalanyl-tRNA--protein transferase [Labrenzia alexandrii
           DFL-11]
          Length = 228

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 119/172 (69%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P +RGI+PL+T H P+RLK+ IR + ++IR +T F+ VI  C+   
Sbjct: 28  MAESADDPGLFWLEPEQRGILPLDTVHVPRRLKRTIRGDFFEIRTSTDFQGVIDGCSAPM 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y +LF MG+ HT+EAW+   LVGGLYGVSL   FFGESMFS   +
Sbjct: 88  PGRQKTWINREIRRLYGELFEMGHCHTVEAWQDGDLVGGLYGVSLNGAFFGESMFSFKTD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL HLV  LKK  + LLD QF+T HL +FG +E+   +Y  LL +AL+
Sbjct: 148 ASKVCLIHLVARLKKGGYTLLDTQFVTGHLAKFGTLEVPKDEYNVLLSSALQ 199


>gi|307947209|ref|ZP_07662544.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseibium sp.
           TrichSKD4]
 gi|307770873|gb|EFO30099.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseibium sp.
           TrichSKD4]
          Length = 235

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 117/173 (67%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P RRGI+PL+ FH P+RL++ IR+++++IR++T F+ VI  CA   
Sbjct: 28  MAESADDPGLFWLEPERRGILPLDGFHLPRRLRRTIRQDIFEIRVSTDFQGVIDGCASPL 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y +LF MGY HT+EAW+   LVGGLYGVSL   FFGESMF+   +
Sbjct: 88  PGRSKTWINKEIRRLYGELFEMGYCHTVEAWQNGELVGGLYGVSLNGAFFGESMFTLETD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           ASK+CL HLV  +    + LLD QF+T+HL +FG  EI    Y   L  ALK 
Sbjct: 148 ASKVCLAHLVARMIVGGYSLLDTQFVTDHLSKFGTQEIAQTDYNGRLSEALKQ 200


>gi|114704668|ref|ZP_01437576.1| leucyl/phenylalanyl-tRNA-protein transferase [Fulvimarina pelagi
           HTCC2506]
 gi|114539453|gb|EAU42573.1| leucyl/phenylalanyl-tRNA-protein transferase [Fulvimarina pelagi
           HTCC2506]
          Length = 222

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 118/172 (68%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA   +I W+ P+ RGI+PL + H P+ LKK IR++++D+R +TAF +V+  CA+ T
Sbjct: 27  MAESAEDPNIFWVDPVERGILPLGSVHIPRSLKKTIRKQIFDVRFDTAFAAVLDGCAEPT 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN T+++ YI L+  G+AH++E W+   LVGGLYGVSLG  FFGESMFS   +
Sbjct: 87  PNRSETWINRTVRELYIALYREGFAHSVETWRDGELVGGLYGVSLGGAFFGESMFSRQTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  L + L +  + LLD QF+T HL +FGAIEI    Y  LL  A++
Sbjct: 147 ASKVALAFLCERLIRGGYSLLDTQFLTEHLERFGAIEIPREDYQALLATAVE 198


>gi|118590073|ref|ZP_01547477.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Stappia
           aggregata IAM 12614]
 gi|118437570|gb|EAV44207.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Stappia
           aggregata IAM 12614]
          Length = 226

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 116/172 (67%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P RRGI+PL  FH P+RL++ IR +++++R++T F+ VI  CA   
Sbjct: 28  MAESADDPGLFWLEPERRGILPLNNFHLPRRLRRTIRNDVFEVRVSTDFQGVIDGCAHPM 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y +LF MGY HTIEAW+   LVGGLYGVSL   FFGESMF+   +
Sbjct: 88  PGRQKTWINREIRRLYGELFDMGYCHTIEAWQDGELVGGLYGVSLNGAFFGESMFTFRTD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+CL HLV  L    + LLD QF+T+HL +FG  E+    Y + L  ALK
Sbjct: 148 ASKVCLAHLVARLIAGGYSLLDTQFVTDHLSKFGTEEVPQAAYNERLSEALK 199


>gi|298291313|ref|YP_003693252.1| leucyl/phenylalanyl-tRNA/protein transferase [Starkeya novella DSM
           506]
 gi|296927824|gb|ADH88633.1| leucyl/phenylalanyl-tRNA/protein transferase [Starkeya novella DSM
           506]
          Length = 225

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + WI+P RRG+IPL+ F    RL + +R + +++RI+  FE+VI  CA   
Sbjct: 27  MAESADDPGLYWIEPERRGVIPLDGFAISSRLARTVRSDKFEVRIDHDFEAVIDGCAAPA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R +TWIN  I+K Y DL+  GY H++E W+   LVGGLYGV LG  FFGESMF    +
Sbjct: 87  DGRGSTWINRRIRKLYCDLYARGYCHSVETWQDGELVGGLYGVRLGRAFFGESMFHTARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  LK+  F LLD QF+T+HL+ FGA+E++   Y KLL +AL+
Sbjct: 147 ASKVALVHLVARLKRGGFTLLDTQFVTDHLKSFGAVEVSRRHYHKLLTHALE 198


>gi|329890101|ref|ZP_08268444.1| leucyl/phenylalanyl-tRNA--protein transferase [Brevundimonas
           diminuta ATCC 11568]
 gi|328845402|gb|EGF94966.1| leucyl/phenylalanyl-tRNA--protein transferase [Brevundimonas
           diminuta ATCC 11568]
          Length = 231

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 118/172 (68%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++ +   +  ++P +RG+IPL+ FH P RL++ +R E + +R+NTAF +V+ ACA   
Sbjct: 31  MAEAHDDPRVFLVEPEQRGVIPLDRFHIPSRLRRTVRGEPFQVRVNTAFAAVLDACAAPA 90

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI+L   G+AH+IE W+ + LVGGLYGV+LG  FFGESMFS   +
Sbjct: 91  PGREDTWINAPIRRLYIELHQRGFAHSIECWRDETLVGGLYGVTLGGAFFGESMFSRATD 150

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L+K  + LLD QF+T+HL QFGA+E     Y ++L  AL+
Sbjct: 151 ASKVALVHLVARLRKGGWRLLDAQFLTDHLSQFGAVETPQEAYLRMLPWALQ 202


>gi|312116103|ref|YP_004013699.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221232|gb|ADP72600.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 230

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 115/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA    + WI+P RRGI+ LE  H P+RL + I++  +++R+++ +  VI  CA   
Sbjct: 27  MAESAEDTTLYWIEPERRGILALEGLHVPRRLARVIKQGKFEVRVDSDYHGVIEGCASSR 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWIN  I++ Y DLF MGY HT+E W+   LVGGLYGV+LG  FFGESMFS+  +
Sbjct: 87  AGRRTTWINRRIRELYADLFDMGYCHTVETWRDGKLVGGLYGVALGRSFFGESMFSYETD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L +L   L+   F LLD QF+T HLRQFGA EI+   + + LE AL+
Sbjct: 147 ASKVALVYLAARLRYGDFCLLDTQFVTEHLRQFGAQEISRAAFHRRLEQALQ 198


>gi|254419389|ref|ZP_05033113.1| leucyl/phenylalanyl-tRNA--protein transferase [Brevundimonas sp.
           BAL3]
 gi|196185566|gb|EDX80542.1| leucyl/phenylalanyl-tRNA--protein transferase [Brevundimonas sp.
           BAL3]
          Length = 228

 Score =  187 bits (476), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 118/173 (68%), Gaps = 1/173 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-K 59
           MADS +   +  I+P +RG+IPL+ FH P RL++ +R E +++RI+TAFE+V+  CA  +
Sbjct: 31  MADSRDDPRVFIIEPEQRGVIPLDGFHIPTRLRRTVRGEPFEVRIDTAFEAVLDGCAAAQ 90

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
             +R  TWIN  I++ Y  LF  G+ H++E WK + L GGLYGVS+G  FFGESMFS   
Sbjct: 91  GPEREDTWINAPIRRLYAALFAQGFVHSVECWKDERLAGGLYGVSVGGAFFGESMFSRER 150

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +ASK+ L HLV  L+K  + LLD QF+T+HL QFGA+E     Y + L+ ALK
Sbjct: 151 DASKVALVHLVARLRKGGWTLLDAQFLTDHLSQFGAVETPQAAYLRRLKPALK 203


>gi|16126128|ref|NP_420692.1| leucyl/phenylalanyl-tRNA--protein transferase [Caulobacter
           crescentus CB15]
 gi|221234899|ref|YP_002517335.1| leucyl/phenylalanyl-tRNA--protein transferase [Caulobacter
           crescentus NA1000]
 gi|33301323|sp|Q9A741|LFTR_CAUCR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|254809116|sp|B8GWN5|LFTR_CAUCN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|13423332|gb|AAK23860.1| leucyl/phenylalanyl-tRNA--protein transferase [Caulobacter
           crescentus CB15]
 gi|220964071|gb|ACL95427.1| leucyl/phenylalanyl-tRNA--protein transferase [Caulobacter
           crescentus NA1000]
          Length = 217

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 111/174 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+   + +  I P RRG++PL TFH PKRL + +R   Y++R++TAF++VI  CA   
Sbjct: 21  MADAREDESLFLIDPERRGVLPLGTFHIPKRLARTVRNGPYEVRVDTAFDTVIENCAASR 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  IQ+ Y  L+  G AH++E W  D LVGGLYGVSLG  FFGESMFS   +
Sbjct: 81  PGRLDTWINHPIQRLYGQLYARGLAHSVETWLGDELVGGLYGVSLGGAFFGESMFSTARD 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV  L    + LLD QF+T HL QFG +EI+   Y + L  AL  P
Sbjct: 141 ASKVALVHLVARLIAGGYELLDTQFLTEHLAQFGVMEISRADYRRRLSKALATP 194


>gi|197105315|ref|YP_002130692.1| leucyl/phenylalanyl-tRNA--protein transferase [Phenylobacterium
           zucineum HLK1]
 gi|226737706|sp|B4RCS6|LFTR_PHEZH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|196478735|gb|ACG78263.1| leucyl/phenylalanyl-tRNA--protein transferase [Phenylobacterium
           zucineum HLK1]
          Length = 221

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 114/174 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+     +  I P RRG+IPLE FH P+RL + +R + ++IRI+ AF  V+ ACA   
Sbjct: 20  MADAREDARVFLIDPERRGVIPLEAFHVPRRLARTVRGDPFEIRIDAAFHDVVLACAASG 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y++L  +G+AH++E W+ + LVGGLYGVSL   FFGESMFS + +
Sbjct: 80  PGRTETWINRPIEQLYLELHELGFAHSVECWQGERLVGGLYGVSLQGAFFGESMFSRVRD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV  L    F LLD QF+T HL QFGA EI   +Y + L+ AL  P
Sbjct: 140 ASKVALVHLVARLIAGGFTLLDAQFMTEHLAQFGAREIPRREYHRRLDRALAAP 193


>gi|90417713|ref|ZP_01225625.1| leucyl/phenylalanyl-tRNA--protein transferase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337385|gb|EAS51036.1| leucyl/phenylalanyl-tRNA--protein transferase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 222

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/171 (49%), Positives = 111/171 (64%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I WI P  RGI+PL+ FH P+ L+K IRR  +DIR++TAF +V+  CA+  
Sbjct: 27  MAEKADDPGIFWIDPTERGILPLDGFHLPRSLRKTIRRAPFDIRVDTAFAAVVDGCAEAA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+   + L   G+AH++E W  D LVGGLYGVSLG  FFGESMFS   +
Sbjct: 87  PGRMETWINGQIRSLTLALAQEGFAHSVEGWDGDQLVGGLYGVSLGGAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L +L + L +  + LLD QF+T HL +FGAIEI    Y  LL  A+
Sbjct: 147 ASKVALAYLWERLCRGGYQLLDTQFLTGHLERFGAIEIDRDTYQALLAEAI 197


>gi|115525000|ref|YP_781911.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris BisA53]
 gi|122295854|sp|Q07MA3|LFTR_RHOP5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|115518947|gb|ABJ06931.1| Leucyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 229

 Score =  183 bits (465), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P +RG+IPL+ F    RL + +R + + + ++ AF++VI  CA   
Sbjct: 27  MAESVDDPTLFWVEPEQRGLIPLDGFKVSSRLARTVRSDAFTVTVDRAFKAVIDGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           Q R  TWIN  I++ YI LF +G+ H++E W+ D LVGGLYGVSLG  FFGESMF    +
Sbjct: 87  QGREDTWINRRIRELYIGLFEIGHCHSVEVWQDDELVGGLYGVSLGRAFFGESMFHRARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L +  + LLD QF+T+HLR FGA+E+   +Y  LL+ ALK
Sbjct: 147 ASKVALVHLVARLLEGGYALLDTQFVTDHLRSFGAVEVPRRRYRTLLDAALK 198


>gi|332187139|ref|ZP_08388879.1| leucyl/phenylalanyl-tRNA--protein transferase [Sphingomonas sp.
           S17]
 gi|332012839|gb|EGI54904.1| leucyl/phenylalanyl-tRNA--protein transferase [Sphingomonas sp.
           S17]
          Length = 248

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 112/171 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+ ++  + W++P +R ++PLE FH  + L+K +  + + +  +TAFES+I  CA+  
Sbjct: 25  MADTRDTDHVYWVEPRKRAVLPLEGFHLSRSLRKTVAADRFRVTADTAFESIIRLCAESV 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I++A+IDLF MG+AH+IE W  D LVGGLYG+SLG  FFGESM S   +
Sbjct: 85  PDRPETWINYAIERAFIDLFDMGFAHSIECWDGDELVGGLYGLSLGRAFFGESMVSRRTD 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L  LV  L+   + LLD QF T HL   GA+EI    Y  LL +AL
Sbjct: 145 ASKVALVWLVARLRAGGYSLLDCQFQTPHLATMGAVEIGRDDYVALLSDAL 195


>gi|154247424|ref|YP_001418382.1| leucyltransferase [Xanthobacter autotrophicus Py2]
 gi|154161509|gb|ABS68725.1| Leucyltransferase [Xanthobacter autotrophicus Py2]
          Length = 223

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 115/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA    + WI+P RRGIIPL+ F    RL + +R + +++R++  F++VI  C++  
Sbjct: 27  MAESAEDPGLYWIEPERRGIIPLDGFQISSRLARTVRSDKFEVRVDHDFDAVIDGCSEPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           + R  TWIN  I+K Y +LF  G  HT+EAW+   LVGGLYGV LG  FFGESMF    +
Sbjct: 87  EGREKTWINERIRKLYGELFLRGRCHTVEAWRDGKLVGGLYGVRLGGAFFGESMFHRETD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L    F LLD QF+T+HL+ FGAIE++   Y +LL++AL+
Sbjct: 147 ASKVALVHLVGRLIAGGFRLLDTQFVTSHLKTFGAIEVSRRHYHRLLDHALQ 198


>gi|260752612|ref|YP_003225505.1| leucyl/phenylalanyl-tRNA--protein transferase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258551975|gb|ACV74921.1| leucyl/phenylalanyl-tRNA/protein transferase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 268

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+DS  + ++ W++P +RGI+PL+ FH  + L K IR + + +  +  FE+VI  CA+ T
Sbjct: 21  MSDSRETDEVYWVEPKKRGILPLDHFHLSRSLAKIIRSDRFLVTADRDFEAVIDLCAEPT 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           + RP +WIN  I+ AY  L  +GYAH+IE W  + LVGGLYGV+LG  FFGESMFS + N
Sbjct: 81  EDRPDSWINPPIRAAYCQLHNLGYAHSIECWLDNRLVGGLYGVNLGYAFFGESMFSRVSN 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  LV  LK   F LLD QFIT+HL   GAIEIT   Y K L++A+ 
Sbjct: 141 ASKVALAWLVARLKVGNFSLLDCQFITDHLASMGAIEITREDYLKRLKSAVS 192


>gi|85716171|ref|ZP_01047146.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrobacter sp.
           Nb-311A]
 gi|85697004|gb|EAQ34887.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrobacter sp.
           Nb-311A]
          Length = 225

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 114/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RG+IPLE+F  P RL + +R + + + I+TAF+ VI+ CA   
Sbjct: 26  MAESVDDPTLFWVEPKMRGVIPLESFRVPSRLARTVRSDSFTVTIDTAFDEVINGCAAPQ 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+ D L GGLYGV LG  FFGESMF  + +
Sbjct: 86  PGRDNTWINHRIRELYIGLHELGHCHSVEVWQNDELAGGLYGVRLGRAFFGESMFHVVRD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L    F+LLD QF+T+HLR FGAIEI   +Y  LL+ AL+
Sbjct: 146 ASKVALVHLVARLIAGGFVLLDTQFVTDHLRGFGAIEIPRRRYRALLDVALE 197


>gi|241761852|ref|ZP_04759938.1| leucyl/phenylalanyl-tRNA/protein transferase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373766|gb|EER63326.1| leucyl/phenylalanyl-tRNA/protein transferase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 268

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+DS  + ++ W++P +RGI+PL+ FH  + L K IR + + +  +  FE+VI  CA+ T
Sbjct: 21  MSDSRETDEVYWVEPKKRGILPLDHFHLSRSLAKIIRSDRFLVTADRDFEAVIDLCAEPT 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           + RP +WIN  I+ AY  L  +GYAH+IE W  + LVGGLYGV+LG  FFGESMFS + N
Sbjct: 81  EDRPDSWINPPIRAAYCQLHNLGYAHSIECWLDNRLVGGLYGVNLGYAFFGESMFSRVSN 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  LV  LK   F LLD QFIT+HL   GAIEIT   Y K L++A+ 
Sbjct: 141 ASKVALAWLVARLKVGNFSLLDCQFITDHLASMGAIEITREDYLKHLKSAVS 192


>gi|296447986|ref|ZP_06889892.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylosinus
           trichosporium OB3b]
 gi|296254496|gb|EFH01617.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylosinus
           trichosporium OB3b]
          Length = 221

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 111/174 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA    + W+ P  R I PL+ F   + L K +R + +++RI+  FE+VI ACA   
Sbjct: 26  MAESAEEDQLFWVDPQERAIFPLDAFKISRSLAKTLRSDRFEVRIDQDFEAVIDACAASA 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            KR  TWIN  I++ Y +LF +G+ HT+E W++  LVGGLYGV++ A FFGESMF    +
Sbjct: 86  PKRENTWINAEIRRLYRELFNLGFVHTVECWREGALVGGLYGVAMRAAFFGESMFHRETD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV  L+   F LLD QFIT HL   GAIEI+   Y  LLE+AL  P
Sbjct: 146 ASKVALAHLVGRLRSGGFRLLDTQFITTHLASLGAIEISRDAYHDLLEHALAAP 199


>gi|167646525|ref|YP_001684188.1| leucyl/phenylalanyl-tRNA--protein transferase [Caulobacter sp. K31]
 gi|189046552|sp|B0SXA5|LFTR_CAUSK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|167348955|gb|ABZ71690.1| Leucyltransferase [Caulobacter sp. K31]
          Length = 217

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 86/170 (50%), Positives = 109/170 (64%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+ + + I  I P RRG++PL+  H P+RL + IR E ++IRI++AF+SV+ ACA   
Sbjct: 21  MADARHDESIFLIDPERRGVLPLDGVHVPRRLARSIRGEPFEIRIDSAFDSVVEACATAR 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  IQ+ Y  LF  G AH++E W  + LVGGLYGV+ G  FFGESMFS   +
Sbjct: 81  PGRLETWINTPIQRLYGQLFARGLAHSVECWDGEELVGGLYGVAFGGCFFGESMFSTRRD 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASK+ L HLV  L    + LLD QFIT HL QFG IEI    Y + L  A
Sbjct: 141 ASKVALIHLVGRLIVGGYQLLDTQFITEHLEQFGTIEIARADYRRRLGRA 190


>gi|148555467|ref|YP_001263049.1| leucyl/phenylalanyl-tRNA--protein transferase [Sphingomonas
           wittichii RW1]
 gi|189046564|sp|A5V9E5|LFTR_SPHWW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|148500657|gb|ABQ68911.1| Leucyltransferase [Sphingomonas wittichii RW1]
          Length = 248

 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 110/168 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS  + D+ W++P +RGI+PL+ F   + L K IR + + +  + AF  V++ CA  T
Sbjct: 20  MADSRAADDVYWVEPKKRGILPLDHFRLSRSLAKTIRSDRFAVTADRAFGEVVAECAAVT 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +RP TWIN  I+ AY DL   G+AH+IE W++  LVGGLYGV LG  FFGESMFS   N
Sbjct: 80  SQRPDTWINPAIEAAYADLHRRGHAHSIECWREGRLVGGLYGVRLGGAFFGESMFSRESN 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           ASK+ L  LV  L+   F LLD QFIT+HL+  GAIE++   Y  LL+
Sbjct: 140 ASKVALAWLVARLRAGGFRLLDCQFITDHLQSLGAIEVSRDDYVALLD 187


>gi|163848898|ref|YP_001636942.1| leucyl/phenylalanyl-tRNA--protein transferase [Chloroflexus
           aurantiacus J-10-fl]
 gi|222526854|ref|YP_002571325.1| leucyl/phenylalanyl-tRNA--protein transferase [Chloroflexus sp.
           Y-400-fl]
 gi|163670187|gb|ABY36553.1| Leucyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222450733|gb|ACM54999.1| leucyl/phenylalanyl-tRNA/protein transferase [Chloroflexus sp.
           Y-400-fl]
          Length = 198

 Score =  180 bits (456), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 4/176 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD+    +I W +P+RR IIPL E FH P+RL + +R   Y +  + AF  VI ACA  
Sbjct: 22  MADARG--EIGWYEPIRRAIIPLDERFHVPRRLARTVRSGFYTVTFDAAFADVIEACAAP 79

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  I +AY +L  +GYAH++E W+   L GGLYGV+LG +F GESMF  M 
Sbjct: 80  APGRETTWISPEIIRAYTELHRLGYAHSVECWRDGQLAGGLYGVALGGLFAGESMFHRMR 139

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITN-HLRQFGAIEITHVQYAKLLENALKHP 174
           +ASK+ L HLV+ L++  F+LLD QF+T  H+ QFGAIEI   +Y +LL  AL  P
Sbjct: 140 DASKVALVHLVERLRRGGFVLLDSQFLTGTHMLQFGAIEIPRAEYHRLLRQALTVP 195


>gi|56551823|ref|YP_162662.1| leucyl/phenylalanyl-tRNA--protein transferase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|81598260|sp|Q5NP09|LFTR_ZYMMO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|56543397|gb|AAV89551.1| leucyl/phenylalanyl-tRNA/protein transferase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 268

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 114/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+DS  + ++ W++P +RGI+P + FH  + L K IR + + +  +  FE+VI  CA+ T
Sbjct: 21  MSDSRETDEVYWVEPKKRGILPPDHFHLSRSLAKIIRSDRFLVTADRDFEAVIDLCAEPT 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           + RP +WIN  I+ AY  L  +GYAH+IE W  + LVGGLYGV+LG  FFGESMFS + N
Sbjct: 81  EDRPDSWINPPIRAAYCQLHNLGYAHSIECWLDNRLVGGLYGVNLGYAFFGESMFSRVSN 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  LV  LK   F LLD QFIT+HL   GAIEIT   Y K L++A+ 
Sbjct: 141 ASKVALAWLVARLKVGNFSLLDCQFITDHLASMGAIEITREDYLKRLKSAVS 192


>gi|114328620|ref|YP_745777.1| leucyl/phenylalanyl-tRNA--protein transferase [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316794|gb|ABI62854.1| leucyl/phenylalanyl-tRNA--protein transferase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 226

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/167 (49%), Positives = 115/167 (68%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++ +   + W+ P  RGI+PL+ FH P+RL + +  E +++RI++ F +VI  CA   
Sbjct: 24  MAETRDGARLYWLDPEERGILPLDGFHLPRRLLRTVLGERFEVRIDSDFPAVIHGCAVPR 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           Q R  +WIN  I++ +IDL  +G+AH++EAW+   LVGGLYGV LGAVFFGESMFS + +
Sbjct: 84  QGRMDSWINAEIKRLFIDLHRIGHAHSVEAWQDGKLVGGLYGVVLGAVFFGESMFSTVRD 143

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           ASK+ LTHLV  L+   F LLD QF+T HL QFGA+EI    Y + L
Sbjct: 144 ASKVALTHLVARLRLGGFRLLDTQFVTTHLTQFGAMEIPREAYRQRL 190


>gi|75675949|ref|YP_318370.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrobacter
           winogradskyi Nb-255]
 gi|119367704|sp|Q3SRS3|LFTR_NITWN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|74420819|gb|ABA05018.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrobacter
           winogradskyi Nb-255]
          Length = 225

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 115/172 (66%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RG++PLE+F  P RL + +R + + + ++TAF++VI+ CA   
Sbjct: 26  MAESVDDPTLFWVEPKMRGVVPLESFRIPSRLARTVRSDSFTVTVDTAFDAVINGCAAPQ 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+ + L GGLYGV LG  FFGESMF  + +
Sbjct: 86  PGRNNTWINHRIRELYIGLHELGHCHSVEVWRDNELAGGLYGVRLGRAFFGESMFHVVRD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L    F+LLD QF+T+HLR FGAIEI   +Y  LL+ AL+
Sbjct: 146 ASKVALVHLVARLIAGGFVLLDTQFVTDHLRGFGAIEIPRRRYRALLDVALE 197


>gi|299133763|ref|ZP_07026957.1| leucyl/phenylalanyl-tRNA/protein transferase [Afipia sp. 1NLS2]
 gi|298591599|gb|EFI51800.1| leucyl/phenylalanyl-tRNA/protein transferase [Afipia sp. 1NLS2]
          Length = 228

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 109/172 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P +RGI PL+  H   RL + +R + Y + +NTAFE VIS CA   
Sbjct: 27  MAESADDPSLFWVEPEQRGIFPLDGLHISSRLARTVRSDRYRVTVNTAFERVISECAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+K Y  L  +G+ H+IEAW  D L GGLYGVSLG  FFGESMF    +
Sbjct: 87  PGREDTWINHRIRKLYGALHGIGHCHSIEAWNGDELAGGLYGVSLGGAFFGESMFHRSRD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HL   L    F LLD QF+T HLR  GAIE++  +Y  LL+ +++
Sbjct: 147 ASKVALVHLAARLIAGGFGLLDTQFVTEHLRSLGAIEVSRRKYRSLLDRSIQ 198


>gi|126727095|ref|ZP_01742932.1| Leucyltransferase [Rhodobacterales bacterium HTCC2150]
 gi|126703523|gb|EBA02619.1| Leucyltransferase [Rhodobacterales bacterium HTCC2150]
          Length = 218

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 110/174 (63%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+A S ++ W++P  RG++PL+ FH  + L + +R   Y+I +N  F +V++ACA   
Sbjct: 22  MADTATSDEVFWVEPKMRGVMPLDGFHISRSLGRALRNCGYEITLNKNFPAVMAACAD-- 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I  AY+D    G AH++E W  + LVGG+YGV+L A FFGESMFSH++N
Sbjct: 80  --RPETWINPMITNAYVDFHERGLAHSVEVWNGEELVGGVYGVALNAAFFGESMFSHVKN 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            SKI LTHLV  L    F L D QFIT HL   G  EI    +   L++AL HP
Sbjct: 138 GSKIALTHLVNQLNATGFKLFDTQFITPHLASMGGQEIPQSAFLVSLDDALAHP 191


>gi|23012572|ref|ZP_00052624.1| COG2360: Leu/Phe-tRNA-protein transferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 240

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 111/158 (70%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA S +   + W+ P +RGI+PL+ FH PK L+K +R   +++  +T FESV+ AC + T
Sbjct: 20  MARSRDENRLYWVDPEQRGILPLDGFHIPKSLRKTLRSGRFEVTCDTQFESVMRACGEAT 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +RP TWIN  I   +++LF +G AH++E  +   LVGGLYG++LGA FFGESMFS   +
Sbjct: 80  IERPETWINEKIISLFVELFELGLAHSVEVRQDGQLVGGLYGLALGAAFFGESMFSRRTD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
           ASK+ L HLV  L++  F LLD QF+T+HL+QFGA+EI
Sbjct: 140 ASKVALVHLVARLRRDGFRLLDTQFVTDHLKQFGAVEI 177


>gi|209885102|ref|YP_002288960.1| leucyl/phenylalanyl-tRNA--protein transferase [Oligotropha
           carboxidovorans OM5]
 gi|226737704|sp|B6JH85|LFTR_OLICO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|209873298|gb|ACI93094.1| leucyl/phenylalanyl-tRNA--protein transferase [Oligotropha
           carboxidovorans OM5]
          Length = 227

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 107/174 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P +RGI PLE      RL + +R + Y I I+TAFE V+  CA   
Sbjct: 27  MAESADDPGLFWVEPEQRGIFPLEALRISSRLARTVRSDRYRITIDTAFERVLGECAAPA 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+K Y  LF +G+ H+IEAW  D L GGLYGVSLG  FFGESMF    +
Sbjct: 87  PGREDTWINNRIRKLYSGLFEIGHCHSIEAWDGDDLAGGLYGVSLGGAFFGESMFHRSRD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            SK+ L HL   L    F LLD QF+T+HLR  GA E+   +Y  LL+ AL+ P
Sbjct: 147 TSKVALVHLAARLIIGGFTLLDTQFVTDHLRSLGATEVPRRKYRALLDRALQLP 200


>gi|27379397|ref|NP_770926.1| leucyl/phenylalanyl-tRNA--protein transferase [Bradyrhizobium
           japonicum USDA 110]
 gi|33301281|sp|Q89MA7|LFTR_BRAJA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|27352548|dbj|BAC49551.1| leucyl/phenylalanyl-tRNA-protein transferase [Bradyrhizobium
           japonicum USDA 110]
          Length = 226

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 112/179 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P  RG+IPL  F    RL + +R + + + +NTAF++ I+ CA   
Sbjct: 27  MAESADDPTLFWVEPELRGVIPLGGFRVASRLARTVRSDGFRVTVNTAFKATIAGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+  Y  LF +G+ H++EAW+ D LVGGLYGVSLG  FFGESMF    +
Sbjct: 87  AGREDTWINKRIRDLYSGLFELGHCHSVEAWQGDDLVGGLYGVSLGRAFFGESMFHTARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASK+ L HLV  L    F LLD Q++T HL+ FGA+EI   +Y  LL+ AL      FL
Sbjct: 147 ASKVALVHLVARLIHGGFELLDTQYVTEHLKNFGAVEIPRRRYTALLDKALAGEPGDFL 205


>gi|92117716|ref|YP_577445.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrobacter
           hamburgensis X14]
 gi|119367701|sp|Q1QLB2|LFTR_NITHX RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91800610|gb|ABE62985.1| Leucyltransferase [Nitrobacter hamburgensis X14]
          Length = 225

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 112/172 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RG+IPLE+F    RL + +R + + + ++TAF +VI  CA   
Sbjct: 27  MAESVDDPTLFWVEPKLRGVIPLESFRISSRLARTVRSDSFAVTVDTAFNAVIDGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+ D LVGGLYGV LG  FFGESMF    +
Sbjct: 87  PGRDNTWINRRIRELYIALHELGHCHSVEVWQGDELVGGLYGVRLGRAFFGESMFHIARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L    F+LLD QF+T+HLR FGAIEI   +Y  LL+ AL+
Sbjct: 147 ASKVALVHLVARLIAGGFVLLDTQFVTDHLRGFGAIEIPRRRYRALLDAALE 198


>gi|148255597|ref|YP_001240182.1| leucyl/phenylalanyl-tRNA--protein transferase [Bradyrhizobium sp.
           BTAi1]
 gi|158513283|sp|A5EJD2|LFTR_BRASB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|146407770|gb|ABQ36276.1| leucyl, phenylalanyl-tRNA-protein transferase [Bradyrhizobium sp.
           BTAi1]
          Length = 226

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 111/178 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P  RG+IPL  F    RL + +R + + + +N AF +V+  CA+  
Sbjct: 27  MAESADDPSLFWVEPELRGVIPLTGFRVSSRLARTVRSDAFTVTVNQAFTAVMDGCAEPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y  L+ +G+ H++E W+   LVGGLYGVSLG  FFGESMF    +
Sbjct: 87  PGREDTWINRRIRELYSGLYALGHCHSVECWQDGDLVGGLYGVSLGRAFFGESMFHRARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+ L HLV  L    F LLD Q++T HL+ FGA+EI   +Y  LLE AL  P  +F
Sbjct: 147 ASKVALVHLVARLIAGGFELLDTQYVTEHLKTFGAVEIPRRRYTGLLEKALTGPAANF 204


>gi|90424372|ref|YP_532742.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris BisB18]
 gi|90424379|ref|YP_532749.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris BisB18]
 gi|119367719|sp|Q213K6|LFTR_RHOPB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|90106386|gb|ABD88423.1| Leucyltransferase [Rhodopseudomonas palustris BisB18]
 gi|90106393|gb|ABD88430.1| Leucyltransferase [Rhodopseudomonas palustris BisB18]
          Length = 230

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 112/171 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P RRGIIPL+ F    RL + +R +++ + ++ AF+ VI  CA   
Sbjct: 27  MAESVDDPTLFWVEPERRGIIPLDGFKVASRLARTVRSDVFTVSVDRAFKQVIDGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L+ +G+ H++E W+ D LVGGLYGV+LG  FFGESMF    +
Sbjct: 87  PGREDTWINRRIRELYIGLYQLGHCHSVEVWQNDDLVGGLYGVNLGRAFFGESMFHRARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L +  F+LLD QF+T HLR FGA E+   +Y  +L+ A+
Sbjct: 147 ASKVALVHLVARLIEGGFVLLDTQFVTEHLRTFGATEVPRRRYRAMLDVAI 197


>gi|146340456|ref|YP_001205504.1| leucyl/phenylalanyl-tRNA--protein transferase [Bradyrhizobium sp.
           ORS278]
 gi|158514220|sp|A4YTQ2|LFTR_BRASO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|146193262|emb|CAL77278.1| leucyl, phenylalanyl-tRNA-protein transferase [Bradyrhizobium sp.
           ORS278]
          Length = 226

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 111/178 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + W++P  RG+IPL+ F    RL + +R + + + +N AF++V+  CA   
Sbjct: 27  MAESADDPSLFWVEPELRGVIPLDGFRVASRLARTVRSDAFTLTVNQAFKAVMDGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y  L  MG+ H++E W+   LVGGLYGVSLG  FFGESMF    +
Sbjct: 87  PGREDTWINRRIRELYGGLHAMGHCHSVECWQDGELVGGLYGVSLGRAFFGESMFHRARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+ L HLV  L    F LLD Q++T HL+ FGA+EI   +Y  LLE AL  P  +F
Sbjct: 147 ASKVALVHLVARLIAGGFELLDTQYVTEHLKTFGAVEIPRRRYTVLLEKALTGPAANF 204


>gi|83593771|ref|YP_427523.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodospirillum
           rubrum ATCC 11170]
 gi|119367720|sp|Q2RRK9|LFTR_RHORT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|83576685|gb|ABC23236.1| Leucyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 213

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 108/172 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA + +   + WI P  RG++PL+  H  + L+K +R   + + I+T F  V+  CA   
Sbjct: 20  MARAHDDPQLYWIDPDERGVLPLDGLHVSRSLRKVLRHCPFTVTIDTVFVEVLKQCAAPV 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+  + DLF +G  H++E W+ D LVGGLYG+++G VFFGESMFS ++N
Sbjct: 80  PGRDETWINAEIEHLFTDLFDLGLGHSVECWQGDQLVGGLYGLAMGGVFFGESMFSRVDN 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  LK+  F LLD QF TNHLR  GA+EI    Y   L NAL+
Sbjct: 140 ASKVALCHLVARLKRGGFRLLDTQFTTNHLRSMGAVEIARPLYHARLGNALQ 191


>gi|302383314|ref|YP_003819137.1| leucyl/phenylalanyl-tRNA/protein transferase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193942|gb|ADL01514.1| leucyl/phenylalanyl-tRNA/protein transferase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 231

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 113/172 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M ++ +   +  ++P  RG+IPL+ FH P RL++ +R E + +R NT F +V+ ACA  +
Sbjct: 31  MGEARDDPRVFLVEPELRGVIPLDGFHIPTRLRRTVRAEPFVVRGNTVFPAVLDACAAPS 90

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y+ L  MG+AH++E W+ + LVGGLYGV+LG  FFGESMFS + +
Sbjct: 91  PGREDTWINGPIRRLYLQLHAMGHAHSLECWRDEELVGGLYGVTLGGAFFGESMFSRVTD 150

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ + HLV  L++  + LLD QF T HL QFG IEI    Y + L  AL+
Sbjct: 151 ASKVAMVHLVARLRRGGWRLLDAQFRTPHLDQFGLIEIPQSAYLERLATALE 202


>gi|300022363|ref|YP_003754974.1| leucyl/phenylalanyl-tRNA/protein transferase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524184|gb|ADJ22653.1| leucyl/phenylalanyl-tRNA/protein transferase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 242

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 110/172 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+   + WI+P +RG++PL+ FH P+RL + +R     ++++  +E VI  CA   
Sbjct: 46  MAESADDPALYWIEPQQRGVLPLDNFHVPRRLLRTVRTTPLQVKVDNDYERVIDGCAAPR 105

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R +TWIN  I+  Y +LF +G  HT+E W  D +VGGLYGV+L + FFGESMFS   +
Sbjct: 106 AGRMSTWINSRIRGLYRELFDLGACHTVEVWHGDQIVGGLYGVALKSAFFGESMFSTERD 165

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L HL   L K  F LLD QF+T HLRQFG IE+    +   LE AL+
Sbjct: 166 ASKIALVHLTARLIKGGFTLLDTQFVTEHLRQFGTIELDRGLFQAQLERALE 217


>gi|114797414|ref|YP_760946.1| leucyl/phenylalanyl-tRNA--protein transferase [Hyphomonas neptunium
           ATCC 15444]
 gi|123323112|sp|Q0BZZ7|LFTR_HYPNA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|114737588|gb|ABI75713.1| leucyl/phenylalanyl-tRNA--protein transferase [Hyphomonas neptunium
           ATCC 15444]
          Length = 258

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 106/172 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS +   +  + P  RGI+PL+ FH PKRLK+ + ++ Y +  +TAF  V+ AC +  
Sbjct: 21  MADSRDDPRLFLVDPDFRGILPLDAFHIPKRLKRRVCQDPYRVSFDTAFTRVVEACGEPH 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I   Y  L   G+AH++E W  D LVGGLYGVSLG  FFGESMFS   +
Sbjct: 81  DNRPNTWINSPIVNLYSALHRQGFAHSVECWDGDQLVGGLYGVSLGGAFFGESMFSRATD 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L HL   L  R ++LLD QF   HL QFG IEI+   +   L+ ALK
Sbjct: 141 ASKIALVHLAARLIDRGYVLLDAQFHNPHLTQFGLIEISRDAFKARLKAALK 192


>gi|94498774|ref|ZP_01305322.1| leu/phe-tRNA-protein transferase [Sphingomonas sp. SKA58]
 gi|94421783|gb|EAT06836.1| leu/phe-tRNA-protein transferase [Sphingomonas sp. SKA58]
          Length = 249

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 111/171 (64%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D  +++D+ W++P  R I+PLE FH    L + +RR+ + +  N AF  +++ CAQ  
Sbjct: 19  MSDDRDARDVYWVEPKYRAILPLEQFHLSHSLARVLRRDRFRVTANRAFGDILALCAQAA 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN  I++AY+DL    +AH+IE W  + LVGGLYGV+LG  FFGESM S   +
Sbjct: 79  PDRPSTWINHAIERAYVDLHARRFAHSIEVWDGEELVGGLYGVALGTAFFGESMVSRRTD 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L  LV  ++   F LLD QF+T+HLR  GAIEI    Y +LL  A+
Sbjct: 139 ASKVALAWLVARMRFAGFTLLDCQFMTDHLRTMGAIEIRQRDYLQLLGAAV 189


>gi|148259695|ref|YP_001233822.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidiphilium cryptum
           JF-5]
 gi|326403335|ref|YP_004283416.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidiphilium
           multivorum AIU301]
 gi|146401376|gb|ABQ29903.1| Leucyltransferase [Acidiphilium cryptum JF-5]
 gi|325050196|dbj|BAJ80534.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidiphilium
           multivorum AIU301]
          Length = 225

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 112/174 (64%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  N+ D+ ++ P RRG++PLE FH P+RL + +R    DI  +  F ++I+ACA + 
Sbjct: 24  MAERRNAADLHFLDPERRGVLPLEAFHLPRRLARTLRNTSLDIVSDRDFPALIAACAARR 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I++ ++DL   G+AH++E W+   LVGGLYG+++G  FFGESM S + +
Sbjct: 84  PVRPETWINEEIERLFVDLHRRGHAHSVEVWQGGELVGGLYGLAIGGAFFGESMVSLVRD 143

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV  L+   F LLD QF+T HL +FGA EI    Y   L  A+  P
Sbjct: 144 ASKLALVHLVARLRLGGFSLLDTQFLTAHLARFGAFEIGRAAYHARLAEAVARP 197


>gi|219847167|ref|YP_002461600.1| leucyl/phenylalanyl-tRNA--protein transferase [Chloroflexus
           aggregans DSM 9485]
 gi|219541426|gb|ACL23164.1| leucyl/phenylalanyl-tRNA/protein transferase [Chloroflexus
           aggregans DSM 9485]
          Length = 198

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 116/174 (66%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD     +I W +P+RR IIPL E FH P+RL + +R   + +  +TAFE VI+ACA  
Sbjct: 22  MADEHG--EIGWYEPIRRAIIPLDERFHVPRRLARTVRSGFFTVTYDTAFEQVITACAAP 79

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R +TWI+  I +AY +L  +GYAH++E W+   L GGLYGV++G +F GESMF  + 
Sbjct: 80  APGRESTWISPEIIRAYSELHRLGYAHSVECWRDGQLAGGLYGVAVGGLFAGESMFHRVR 139

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITN-HLRQFGAIEITHVQYAKLLENALK 172
           +ASK+ L HLV+ L++  F+LLD QFI   HL QFG IEI+  +Y +LL  AL+
Sbjct: 140 DASKVALVHLVERLRRGGFVLLDSQFIVGPHLLQFGTIEISRAEYHRLLRAALQ 193


>gi|170743519|ref|YP_001772174.1| leucyltransferase [Methylobacterium sp. 4-46]
 gi|168197793|gb|ACA19740.1| Leucyltransferase [Methylobacterium sp. 4-46]
          Length = 228

 Score =  174 bits (441), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 2/176 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RGI+PL+ FH   RL + +R +  ++ ++  F++VI+ACA   
Sbjct: 25  MAEDADDPAIYWVEPRERGIMPLDRFHVSSRLARTVRSDAVEVAVDRDFDAVIAACAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIE--AWKKDVLVGGLYGVSLGAVFFGESMFSHM 118
           +    TWIN  I+  Y +LF +GY HT+E  A     LVGGLYGV+LG  FFGESMF   
Sbjct: 85  RDSARTWINGRIRALYGELFDLGYCHTVEVYAGTPRSLVGGLYGVALGGAFFGESMFHFA 144

Query: 119 ENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +ASKI L HL   L++  + LLD QF+T+HL QFGA+E+    Y +LL  A++HP
Sbjct: 145 RDASKIALVHLAARLRRDGYRLLDAQFVTSHLAQFGAVEVPRQVYKRLLREAVEHP 200


>gi|209545059|ref|YP_002277288.1| leucyl/phenylalanyl-tRNA/protein transferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532736|gb|ACI52673.1| leucyl/phenylalanyl-tRNA/protein transferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 227

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 107/174 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A S  + W  P  RGI+PL+ FH P+RL + +  + +DI  +  FE+ I ACA   
Sbjct: 25  MAPDAESAHLDWYDPDMRGILPLDAFHVPRRLLRTVLSDRFDIVADRHFEATIRACAAPA 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWIN  I + + DL  MGYAH++E+W+  VLVGGLYGV++G  FFGESMFS   +
Sbjct: 85  PGRETTWINERIVRLFCDLHDMGYAHSVESWQDGVLVGGLYGVAIGGAFFGESMFSRRTD 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK  L  LV  L+   F LLD QF T HL +FG IEI   +Y + L  AL  P
Sbjct: 145 ASKAALVSLVARLRIGGFALLDTQFGTAHLARFGGIEIPAWRYKRRLARALALP 198


>gi|220925867|ref|YP_002501169.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylobacterium
           nodulans ORS 2060]
 gi|219950474|gb|ACL60866.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylobacterium
           nodulans ORS 2060]
          Length = 219

 Score =  173 bits (439), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 112/176 (63%), Gaps = 2/176 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RGI+PL+ FH   RL + +R   +++  +  F+ VI+ CA   
Sbjct: 25  MAEDADDPAIYWVEPRERGILPLDRFHVASRLARTVRSGGFEVVTDRDFDGVIAGCAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKD--VLVGGLYGVSLGAVFFGESMFSHM 118
           +    TWIN  I+  Y +LF +GY HT+E +  +  VLVGGLYGVSLG  FFGESMF   
Sbjct: 85  RDSARTWINSRIRALYGELFDLGYCHTVEVYAGEPRVLVGGLYGVSLGGAFFGESMFHLA 144

Query: 119 ENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +ASK+ L HL   L++  + LLD QF+T+HL QFGA+E+    Y +LL  A++HP
Sbjct: 145 RDASKVALVHLAARLRRDGYRLLDAQFVTSHLTQFGAVEVPRQVYKRLLREAVEHP 200


>gi|91976897|ref|YP_569556.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris BisB5]
 gi|123735443|sp|Q137T4|LFTR_RHOPS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91683353|gb|ABE39655.1| Leucyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 224

 Score =  173 bits (439), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 107/171 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RGIIPL  F    RL + +R +++ + +N  F  VI  CA   
Sbjct: 27  MAESIDDPTLFWVEPELRGIIPLGGFRVASRLARTVRSDVFTVTVNRDFRGVIDGCASPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+ D LVGGLYGVSLG  FFGESMF    +
Sbjct: 87  PGRDDTWINRRIRELYIGLHGIGHCHSVEVWQDDDLVGGLYGVSLGRAFFGESMFHRARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L    + LLD QF+T HLR FGAIE+   +Y  LL++AL
Sbjct: 147 ASKVALVHLVARLLAGGYELLDTQFVTEHLRSFGAIEVPRQRYRALLDDAL 197


>gi|83858503|ref|ZP_00952025.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853326|gb|EAP91178.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanicaulis
           alexandrii HTCC2633]
          Length = 216

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 112/178 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   +  ++P  RG+IPL+ FH PK LKK +R++ +   +N  FE+V+ +CA   
Sbjct: 20  MAESRSDTRVYLLEPDERGVIPLDRFHIPKSLKKTVRQDAFTFTVNRCFETVVRSCAAPA 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  +WIN  I   Y+D+   G+AH+IEAWK   L GGLYGVSLGA FFGESMFS   +
Sbjct: 80  PGREDSWINDQILMLYLDMHAEGHAHSIEAWKDGKLAGGLYGVSLGAAFFGESMFSRETD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK  L  LV  L+   + LLD QF T+HL++FGA  I+   Y  LL+ A++ P   F
Sbjct: 140 ASKAALVALVARLRTGGYQLLDTQFNTDHLKRFGAETISQASYRDLLDAAIEQPSDFF 197


>gi|329850494|ref|ZP_08265339.1| leucyl/phenylalanyl-tRNA--protein transferase [Asticcacaulis
           biprosthecum C19]
 gi|328840809|gb|EGF90380.1| leucyl/phenylalanyl-tRNA--protein transferase [Asticcacaulis
           biprosthecum C19]
          Length = 228

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 111/172 (64%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D+ +   +  + P  RG++PL+ FH P RL + +R++ Y +RI++AF+ VI  CA+++
Sbjct: 20  MSDARDDDYLFLVDPPMRGVLPLDAFHIPSRLARTVRKDDYTVRIDSAFQQVIELCAEES 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R +TWI+ +IQ  Y  LF  G AH++E W++  L+GGLYGV++G  FFGESM S   +
Sbjct: 80  VNRTSTWISHSIQALYQALFARGLAHSVEVWREGQLIGGLYGVAIGGAFFGESMVSRATD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L HLV  LK   F LLD QF T HL QFG +EI    Y  LL  A+ 
Sbjct: 140 ASKIALVHLVARLKAGGFKLLDCQFQTEHLSQFGVLEIEKAGYLTLLAAAVD 191


>gi|304321754|ref|YP_003855397.1| leucyl/phenylalanyl-tRNA-protein transferase [Parvularcula
           bermudensis HTCC2503]
 gi|303300656|gb|ADM10255.1| leucyl/phenylalanyl-tRNA-protein transferase [Parvularcula
           bermudensis HTCC2503]
          Length = 222

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 109/171 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+   ++++ W++P  RG+IPL+ FH PK L+K +R++ +++R+NTAF  V+  CA   
Sbjct: 26  MAEDRFAKEVFWVRPDIRGVIPLKGFHLPKSLRKVVRQDRFEVRLNTAFREVMRGCAAPR 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I   Y  L   G AH+IE+W+   LVGGLYGVS+G  FFGESMFS   +
Sbjct: 86  TNREQTWINGQILDVYDRLHLQGNAHSIESWRDGQLVGGLYGVSIGGAFFGESMFSTETD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L    F LLD QF  +HL QFGA EI   +Y  +L  AL
Sbjct: 146 ASKVALVHLVGRLLAGGFRLLDAQFQNDHLTQFGAQEIVAKEYQHMLNEAL 196


>gi|154253732|ref|YP_001414556.1| leucyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154157682|gb|ABS64899.1| Leucyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 249

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 107/170 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++ +   + WI P  RGI+PL  FH PKRL++ IR+  + +RI+TAF  V+  CA+  
Sbjct: 53  MAEARDDPQLYWIDPEARGILPLTDFHVPKRLRRTIRQAPFTVRIDTAFREVMLGCAENG 112

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I   Y DL   G AH++E W  D LVGGLYGVSLGA FFGESMFS   +
Sbjct: 113 PNRNGTWINDRIISLYCDLHERGRAHSVECWLDDRLVGGLYGVSLGAAFFGESMFSRETD 172

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASK+ L +L   L    + LLD QF+T HL+QFGA E++   Y  +L  A
Sbjct: 173 ASKVALVYLAARLIAGGYKLLDTQFVTTHLQQFGAKEVSRNVYRSMLFEA 222


>gi|296534041|ref|ZP_06896554.1| leucyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296265630|gb|EFH11742.1| leucyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 225

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 104/171 (60%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S   + + W+ P  RGI+PLE FH P+RL + +    Y + +N AF + I+ CA   
Sbjct: 28  MAESREGRRLYWLDPELRGILPLEGFHLPRRLLRTVLSGPYRVTVNQAFAATIAGCAAPA 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  +WIN  I+  +  L  MG+ H++E W +  LVGGLYGV+LG  FFGESMFS   +
Sbjct: 88  PGREDSWINPEIETLFTTLHRMGHGHSVETWAEGELVGGLYGVALGGAFFGESMFSRARD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   F LLD QFIT HL QFGA EI    Y + L  A+
Sbjct: 148 ASKVALVHLVARLRLGGFTLLDTQFITGHLAQFGACEIPRAAYKQRLAEAM 198


>gi|218506581|ref|ZP_03504459.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium etli
           Brasil 5]
          Length = 157

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/131 (59%), Positives = 99/131 (75%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR + AFESVI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDHFHISKSLAKTVRRHPFEIRFDHAFESVITACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINQTIRSLYSTLFDMGHAHTVEAWDGDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVK 131
           ASKICL HLV 
Sbjct: 147 ASKICLVHLVD 157


>gi|110680057|ref|YP_683064.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter
           denitrificans OCh 114]
 gi|118572942|sp|Q165G5|LFTR_ROSDO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|109456173|gb|ABG32378.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Roseobacter denitrificans OCh 114]
          Length = 210

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 108/179 (60%), Gaps = 5/179 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  DI W+ PLRRGI+PL  FH  + L++ + R  +DIRI+  F  V+  CA   
Sbjct: 19  MAEHRDDPDIFWVDPLRRGIMPLRGFHMSRSLRRQMLRTAFDIRIDQDFAGVVDGCA--- 75

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y  L     AH++E W+ D LVGG+YGV+LGA FFGESMFS   N
Sbjct: 76  -DRADTWINDEIRRLYNILHAQDRAHSLEVWEGDTLVGGVYGVTLGAAFFGESMFSRRSN 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASKI L  LV  L    F L D QF+T HL   GAIEI+  QY K L+ A   P  SFL
Sbjct: 135 ASKIALACLVDRLLDGGFALFDTQFLTEHLASLGAIEISRAQYQKRLQEACARPA-SFL 192


>gi|316934412|ref|YP_004109394.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodopseudomonas
           palustris DX-1]
 gi|315602126|gb|ADU44661.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodopseudomonas
           palustris DX-1]
          Length = 225

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (64%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RGIIPL  F    RL + +R +++ + ++  F++VI  CA   
Sbjct: 27  MAESVDDPSLFWVEPDMRGIIPLGGFRVTSRLARTVRSDVFTVTVDRDFKAVIDGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+   L GGLYGVSLG  FFGESMF  + +
Sbjct: 87  PGRDDTWINRRIRELYIGLHEIGHCHSVEVWQDGDLAGGLYGVSLGRAFFGESMFHRVRD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L    + LLD QF+T+HL+ FGAIE+  ++Y  LL++AL+
Sbjct: 147 ASKVALVHLVARLLAGGYTLLDTQFVTDHLKSFGAIEVPRLRYRSLLDDALE 198


>gi|192291086|ref|YP_001991691.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris TIE-1]
 gi|226737714|sp|B3QH27|LFTR_RHOPT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|192284835|gb|ACF01216.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodopseudomonas
           palustris TIE-1]
          Length = 225

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 112/178 (62%), Gaps = 1/178 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RGIIPL  F    RL + +R + + + +N  F++VI  CA   
Sbjct: 28  MAESVDDPSLFWVEPDMRGIIPLGGFRVSSRLARTVRSDAFTVTVNRDFKAVIDGCAAPQ 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+   L GGLYGVSLG  FFGESMF    +
Sbjct: 88  PGRDDTWINRRIRELYIGLHDIGHCHSVEVWQDGDLAGGLYGVSLGRAFFGESMFHRARD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+ L HLV  L    + LLD QF+T+HL+ FGAIE+  ++Y  LL+++L+  E SF
Sbjct: 148 ASKVALVHLVARLLAGGYTLLDTQFVTDHLKSFGAIEVPRLRYRSLLDDSLEG-EASF 204


>gi|114569814|ref|YP_756494.1| leucyl/phenylalanyl-tRNA--protein transferase [Maricaulis maris
           MCS10]
 gi|122316200|sp|Q0AQ81|LFTR_MARMM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|114340276|gb|ABI65556.1| Leucyltransferase [Maricaulis maris MCS10]
          Length = 216

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 106/171 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +   I  + P  RGIIPL+ FH  + L+K +R+++Y + IN  FE+V++ CAQ  
Sbjct: 20  MAEGRDDPRIYLLDPDERGIIPLDQFHASRSLRKTVRQDVYQVTINQDFEAVVAGCAQSA 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN +I + Y  L   GYAH++E W    LVGGLYGVSLGA FFGESMFS   +
Sbjct: 80  PGREETWINESIIRLYSQLHDAGYAHSVECWSGADLVGGLYGVSLGAAFFGESMFSLRRD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HL+  L+   + LLD QF T HL  FGA  I+   Y + L  AL
Sbjct: 140 ASKVALVHLIARLRAGGYSLLDTQFTTEHLESFGARTISRSDYRERLAEAL 190


>gi|218663545|ref|ZP_03519475.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium etli
           IE4771]
          Length = 158

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 77/131 (58%), Positives = 98/131 (74%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR + AFE VI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDRFHVSKSLAKTVRRHPFEIRFDHAFEQVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN TI+  Y  LF MG+AHT+EAW  D LVGGLYGVSLG+ FFGESMFS   +
Sbjct: 87  SGRPSTWINQTIRSLYSTLFDMGHAHTVEAWHGDELVGGLYGVSLGSAFFGESMFSRRTD 146

Query: 121 ASKICLTHLVK 131
           ASKICL HLV 
Sbjct: 147 ASKICLVHLVD 157


>gi|118572941|sp|Q6N734|LFTR_RHOPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 225

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 111/178 (62%), Gaps = 1/178 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RGIIPL  F    RL + +R + + + +N  F++VI  CA   
Sbjct: 28  MAESVDDPSLFWVEPDLRGIIPLGGFRVSSRLARTVRSDAFTVTVNRDFKAVIDGCAAPQ 87

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G  H++E W+   L GGLYGVSLG  FFGESMF    +
Sbjct: 88  PGRDDTWINRRIRELYIGLHDIGRCHSVEVWQDGDLAGGLYGVSLGRAFFGESMFHRARD 147

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+ L HLV  L    + LLD QF+T+HL+ FGAIE+  ++Y  LL++AL+  E SF
Sbjct: 148 ASKVALVHLVARLLAGGYTLLDTQFVTDHLKSFGAIEVPRLRYRSLLDDALEG-EASF 204


>gi|56695910|ref|YP_166261.1| leucyl/phenylalanyl-tRNA--protein transferase [Ruegeria pomeroyi
           DSS-3]
 gi|81558654|sp|Q5LUP4|LFTR_SILPO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|56677647|gb|AAV94313.1| leucyl/phenylalanyl-tRNA--protein transferase [Ruegeria pomeroyi
           DSS-3]
          Length = 210

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 108/172 (62%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  N  D+ W+ P+RRG+ PL  FH  + L + +RR  Y + I+  F  V+  CA + 
Sbjct: 19  MAEHRNDPDVFWVDPIRRGVFPLNGFHLSRSLARRMRRGGYQVSIDRDFAGVLDGCADRA 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+ +Y+ L ++G+AH++E W+   L+GG+YGV LGA FFGESMFS   +
Sbjct: 79  E----TWINPEIRASYLALHHLGHAHSLEVWQAGQLIGGVYGVVLGAAFFGESMFSRRTD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L HLV  L++  F L D QF+T HL   GA+EI   +Y + LE AL 
Sbjct: 135 ASKIALAHLVDRLRQTGFALFDTQFLTAHLASLGAVEIPRAEYRRQLERALN 186


>gi|39935495|ref|NP_947771.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris CGA009]
 gi|39649347|emb|CAE27870.1| putative leucyl/phenylalanyl-tRNA-protein transferase
           [Rhodopseudomonas palustris CGA009]
          Length = 227

 Score =  171 bits (433), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 111/178 (62%), Gaps = 1/178 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RGIIPL  F    RL + +R + + + +N  F++VI  CA   
Sbjct: 30  MAESVDDPSLFWVEPDLRGIIPLGGFRVSSRLARTVRSDAFTVTVNRDFKAVIDGCAAPQ 89

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G  H++E W+   L GGLYGVSLG  FFGESMF    +
Sbjct: 90  PGRDDTWINRRIRELYIGLHDIGRCHSVEVWQDGDLAGGLYGVSLGRAFFGESMFHRARD 149

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+ L HLV  L    + LLD QF+T+HL+ FGAIE+  ++Y  LL++AL+  E SF
Sbjct: 150 ASKVALVHLVARLLAGGYTLLDTQFVTDHLKSFGAIEVPRLRYRSLLDDALEG-EASF 206


>gi|163795174|ref|ZP_02189142.1| Leucyltransferase [alpha proteobacterium BAL199]
 gi|159179572|gb|EDP64101.1| Leucyltransferase [alpha proteobacterium BAL199]
          Length = 217

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 110/174 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +     ++ P RRGIIPL+ FH  + L+K +R+  + +  +  F S ++ CA+ T
Sbjct: 20  MAEGRDDPRTFFVDPDRRGIIPLDGFHVSRSLRKTVRQRRFQVTCDRDFASTLAGCAEST 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           ++RP TWIN  I   ++ L   G+AH+IE     +LVGGLYGV +G  FFGESMFS   +
Sbjct: 80  EQRPDTWINREIFSLFVALHERGHAHSIEVRHNGILVGGLYGVRIGGAFFGESMFSRETD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV  L+   FLLLD QFIT HL++FGA+EI   +Y   L+ A+  P
Sbjct: 140 ASKVALVHLVARLRAGGFLLLDSQFITGHLQRFGAVEIPREEYRSRLQQAIATP 193


>gi|196234634|ref|ZP_03133452.1| leucyl/phenylalanyl-tRNA/protein transferase [Chthoniobacter flavus
           Ellin428]
 gi|196221303|gb|EDY15855.1| leucyl/phenylalanyl-tRNA/protein transferase [Chthoniobacter flavus
           Ellin428]
          Length = 202

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 115/167 (68%), Gaps = 4/167 (2%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
            + +I+W  P  R IIPL+TFH P  LK+ +++  ++IRI+TAFE+V+ ACAQ+ +    
Sbjct: 21  ENGEIAWFSPDPRAIIPLDTFHVPHGLKRTLKKTKFEIRIDTAFEAVMRACAQRDE---- 76

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWIN  I  +Y++L   G+AH++EAW  + LVGGLYGVS+G  FFGESMF    +ASK+ 
Sbjct: 77  TWINDVIVASYVNLHREGHAHSVEAWLGEKLVGGLYGVSIGGAFFGESMFHEATDASKVA 136

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           L  LV+ L+ R F LLD Q++T HL  FGAIEI  ++Y + L  A++
Sbjct: 137 LHALVERLRARGFALLDTQWLTPHLVTFGAIEIPRLEYQRRLGEAVE 183


>gi|86137321|ref|ZP_01055898.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter sp.
           MED193]
 gi|85825656|gb|EAQ45854.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter sp.
           MED193]
          Length = 210

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 108/173 (62%), Gaps = 4/173 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+    +++ W+ P  RGI PL+ FH  + L K IRR  Y + +N AF  V+ ACA +T
Sbjct: 19  MAEHREDEEVFWVDPKHRGIFPLDGFHISRSLAKTIRRADYAVSVNRAFSDVVMACADRT 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I   Y DL  MG+AH++E W +D LVGG+YGVSLG  FFGESMFS   +
Sbjct: 79  E----TWINAEIFARYQDLHAMGHAHSLEVWDQDRLVGGVYGVSLGGGFFGESMFSRQRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            SKI L +L+  L++  F L D QF+T HL   GAIEI+   Y   L+ AL+H
Sbjct: 135 TSKIALAYLMDRLRQSGFQLCDTQFLTPHLASLGAIEISRAAYKARLQLALEH 187


>gi|193214356|ref|YP_001995555.1| leucyl/phenylalanyl-tRNA/protein transferase [Chloroherpeton
           thalassium ATCC 35110]
 gi|193087833|gb|ACF13108.1| leucyl/phenylalanyl-tRNA/protein transferase [Chloroherpeton
           thalassium ATCC 35110]
          Length = 201

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 114/174 (65%), Gaps = 1/174 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADSAN + I W  P +R IIPL+ F   + L++ I++ L+++RIN  FE VI  CA   
Sbjct: 25  MADSANGE-IRWYLPKKRAIIPLDEFKVARSLRQVIKKGLFEVRINCNFEQVIKNCAAPR 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I   Y +L Y G+AH++E++ +  L GGLYGVS+G VFFGESMF  + N
Sbjct: 84  EDDEQTWISHEIMAVYTELHYRGFAHSVESYYQGELAGGLYGVSIGGVFFGESMFYRVPN 143

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L  LV  L+ R F LLD QF+  ++++FGAIEI+H  Y   L+ A+ +P
Sbjct: 144 ASKVALHALVSRLRDRDFDLLDSQFMNENVKRFGAIEISHDDYMARLQKAIYNP 197


>gi|126741251|ref|ZP_01756930.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter sp.
           SK209-2-6]
 gi|126717656|gb|EBA14379.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter sp.
           SK209-2-6]
          Length = 212

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 107/172 (62%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+     +I W+ P RRGI PLE FH  + L K IRR  Y++ +N AF  V+SACA + 
Sbjct: 21  MAEHREDDEIFWVDPKRRGIFPLEDFHVSRSLAKRIRRGEYEVSVNRAFPQVVSACADRA 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I   Y DL  MG+AH++E W + VL GG+YGVSLG  FFGESMFS   +
Sbjct: 81  E----TWINSEIHARYQDLHAMGHAHSLEVWHQGVLSGGVYGVSLGGAFFGESMFSRRTD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L +L+  L +  + L D QF+T HL   GA+EI+   Y   L+ AL+
Sbjct: 137 ASKVALAYLIDRLIQGGYALCDTQFLTAHLASLGAVEISRAAYKAKLDIALR 188


>gi|323137692|ref|ZP_08072768.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylocystis sp.
           ATCC 49242]
 gi|322396989|gb|EFX99514.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylocystis sp.
           ATCC 49242]
          Length = 223

 Score =  170 bits (431), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 108/171 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA    + W+ P +R I PL+TF   + L K +R + +++ ++  F++VI ACA   
Sbjct: 26  MAESAEDDQLFWVDPEKRAIFPLDTFIVSRSLAKTVRSDRFEVTVDRDFDAVIDACAAPA 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y +LF MG+ HT+E  ++  LVGGLYGVSL   FFGESMF    +
Sbjct: 86  PDREKTWINAEIRRLYRELFDMGFVHTVECRREGRLVGGLYGVSLRGAFFGESMFHRERD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ LTHLV  L+   F LLD QF+T HL   GAIEI+   Y + LE AL
Sbjct: 146 ASKVALTHLVARLRAGGFQLLDTQFMTTHLASLGAIEISRDAYHRALEEAL 196


>gi|114771114|ref|ZP_01448554.1| possible leucyl/phenylalanyl-tRNA--protein transferase [alpha
           proteobacterium HTCC2255]
 gi|114548396|gb|EAU51282.1| possible leucyl/phenylalanyl-tRNA--protein transferase [alpha
           proteobacterium HTCC2255]
          Length = 195

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 111/171 (64%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+A S ++ W++P  RGIIPL  FH  + LK+ I++  Y +  ++ F  V+SACA + 
Sbjct: 23  MADNAKSNEVYWVEPKLRGIIPLNGFHVSRSLKRVIKKADYTVTFDSQFNEVVSACADRN 82

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN +I ++Y  LF +G AH++E  K   L+GG+YGV+LG+ FFGESMFS   N
Sbjct: 83  E----TWINSSIYESYQKLFKIGNAHSVEIIKNKKLIGGVYGVTLGSAFFGESMFSKESN 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            SKI L HLV HL    F L D QF  +HL+  G IEIT  +Y KLL+ AL
Sbjct: 139 GSKIALKHLVDHLNICGFTLFDAQFQNSHLQTLGCIEITQKKYLKLLKGAL 189


>gi|86750142|ref|YP_486638.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris HaA2]
 gi|119367718|sp|Q2IVN3|LFTR_RHOP2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|86573170|gb|ABD07727.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodopseudomonas
           palustris HaA2]
          Length = 224

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 107/172 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W++P  RGIIPL  F    RL + +R + + + +N  F+ VI  CA   
Sbjct: 27  MAESVDDPTLFWVEPELRGIIPLGGFRVASRLARTVRSDAFTVTVNRDFKGVIDGCAAPQ 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ YI L  +G+ H++E W+   L GGLYGVSLG  FFGESMF    +
Sbjct: 87  PGRDDTWINRRIRELYIGLHGIGHCHSVEVWQDGDLAGGLYGVSLGRAFFGESMFHRARD 146

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L    + LLD QF+T+HLR FGAIE+   +Y  +L++AL+
Sbjct: 147 ASKVALVHLVARLLAGGYELLDTQFVTDHLRSFGAIEVPRQRYRSMLDDALQ 198


>gi|294013325|ref|YP_003546785.1| leucyl/phenylalanyl-tRNA-protein transferase [Sphingobium japonicum
           UT26S]
 gi|292676655|dbj|BAI98173.1| leucyl/phenylalanyl-tRNA-protein transferase [Sphingobium japonicum
           UT26S]
          Length = 249

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D   + ++ WI+P RR I+PL  FH    L K IRRE + +  N  F  ++  CA+  
Sbjct: 14  MSDDREADEVYWIEPKRRAIMPLHGFHISHSLAKTIRRERFRVTANRDFAGIVRLCAEAA 73

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWIN  I++AY  L  +G+AH++E W+ + LVGGLYGV+LG  FFGESM S   +
Sbjct: 74  PDRPSTWINHPIERAYRHLHEIGFAHSVEIWEGEELVGGLYGVALGRAFFGESMVSRRTD 133

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  L   ++   F LLD QF+T+HLR  GAIEI+   Y + L  AL 
Sbjct: 134 ASKVALAWLTARMRFGGFTLLDCQFMTDHLRSLGAIEISQRDYLQSLAGALD 185


>gi|163731531|ref|ZP_02138978.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Roseobacter litoralis Och 149]
 gi|161394985|gb|EDQ19307.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Roseobacter litoralis Och 149]
          Length = 210

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 107/174 (61%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  DI W+ PLRRG++PL  FH  + L++ + R  ++IR++  F  V+  CA   
Sbjct: 19  MAEHRDDPDIFWVDPLRRGVMPLREFHVSRSLRRQMLRTGFEIRVDQDFAGVVDGCA--- 75

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+  Y  L     AH++E W++D LVGG+YGV+LGA FFGESMFS   N
Sbjct: 76  -DRADTWINDEIRSLYNALHERDQAHSLEVWEEDTLVGGVYGVTLGAAFFGESMFSRRTN 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASKI L  LV  L    F L D QF+T+HL   GAIEI+  +Y K L++A   P
Sbjct: 135 ASKIALACLVDRLLDGGFALFDTQFLTDHLASLGAIEISRAEYQKALQSACARP 188


>gi|103487773|ref|YP_617334.1| leucyl/phenylalanyl-tRNA--protein transferase [Sphingopyxis
           alaskensis RB2256]
 gi|98977850|gb|ABF54001.1| Leucyltransferase [Sphingopyxis alaskensis RB2256]
          Length = 237

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 106/171 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD A+   + W++P  R I+PL+ FH  + L+K I  E + +  +TAF  +++ CA+  
Sbjct: 1   MADGADDPSVHWVEPRLRAILPLDGFHLSRSLRKAILAERFRVTTDTAFADMVALCAESA 60

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RPTTWIN  I+ +Y  LF +G+AH++E W+   LVGGLYGV+LG  FFGESM S   +
Sbjct: 61  DDRPTTWINPVIKASYDRLFRLGHAHSVECWQGGELVGGLYGVTLGRAFFGESMVSRARD 120

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L    + LLD QF+T HL   GAIEI    Y   L + L
Sbjct: 121 ASKVALAHLVARLIAGGWKLLDCQFLTPHLASLGAIEIRQADYLARLYSVL 171


>gi|259416038|ref|ZP_05739958.1| leucyl/phenylalanyl-tRNA--protein transferase [Silicibacter sp.
           TrichCH4B]
 gi|259347477|gb|EEW59254.1| leucyl/phenylalanyl-tRNA--protein transferase [Silicibacter sp.
           TrichCH4B]
          Length = 210

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 106/173 (61%), Gaps = 4/173 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  ++ W+ P RRGI+PL+ F   + L K +RR+ Y+I +N  F  V+  CA + 
Sbjct: 19  MAESRDDPEVFWVDPKRRGILPLDGFRISRSLGKRLRRDDYEISVNRDFAGVVHGCADRE 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I   Y++L  MG+AH++E W    LVGG+YGVSLGA FFGESMFS   +
Sbjct: 79  E----TWINEEIFDRYLELHLMGFAHSLEVWMDGALVGGVYGVSLGAAFFGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           ASKI L +LV  L    + L D QFIT HL   G  EI+  +Y +LL  AL  
Sbjct: 135 ASKIALAYLVDRLNAGGYTLCDTQFITPHLASLGGEEISRARYRRLLAEALDQ 187


>gi|149916370|ref|ZP_01904890.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter
           sp. AzwK-3b]
 gi|149809824|gb|EDM69676.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter
           sp. AzwK-3b]
          Length = 216

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 108/174 (62%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+++ N  +I W+ P RRG++PL  FH  + L + +R+  Y + ++  F  V++ACA + 
Sbjct: 24  MSENRNDPEIFWVDPRRRGVLPLNGFHISRSLARRMRQAAYSVTMDADFAGVLNACADRE 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I + Y++L +MG AH++E W+   L GG+YGV+LG  FFGESMFS   +
Sbjct: 84  E----TWINAEIHRLYMELHHMGTAHSLEIWQDGALAGGVYGVALGGAFFGESMFSRRTD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HL  HL++  F L D QFIT HL   GA+EI+   Y   L  AL  P
Sbjct: 140 ASKLALAHLTDHLRRCGFSLFDTQFITPHLASLGAVEISRSDYHARLREALDLP 193


>gi|315499993|ref|YP_004088796.1| leucyl/phenylalanyl-tRNA/protein transferase [Asticcacaulis
           excentricus CB 48]
 gi|315418005|gb|ADU14645.1| leucyl/phenylalanyl-tRNA/protein transferase [Asticcacaulis
           excentricus CB 48]
          Length = 216

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D+ + + +  + P  RGI+PLE    P RL + +R   + ++I+TAF  VI  CA+  
Sbjct: 20  MSDARDDETLFLVDPPLRGILPLEGVRVPSRLARTVRNTPFTVKIDTAFRQVIELCAESA 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R +TWI+ +IQ+ Y  LF  G AH++E W    LVGGLYGV++   FFGESM S   +
Sbjct: 80  ADRESTWISHSIQELYEALFARGLAHSVEVWDGTRLVGGLYGVAINGAFFGESMVSRATD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L HLV  L+   + LLD QF+T+HLRQFG IEI    Y   L++AL 
Sbjct: 140 ASKIALVHLVARLRAGGYRLLDCQFLTDHLRQFGVIEIPREDYKARLKDALS 191


>gi|329114240|ref|ZP_08243002.1| Leucyl/phenylalanyl-tRNA--protein transferase [Acetobacter pomorum
           DM001]
 gi|326696316|gb|EGE47995.1| Leucyl/phenylalanyl-tRNA--protein transferase [Acetobacter pomorum
           DM001]
          Length = 226

 Score =  167 bits (423), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 106/172 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A    + W  P  RGI+PL+ FH P+RL++ +    +D+ ++  F +++ ACA   
Sbjct: 34  MASDATDTTLRWYDPDPRGILPLDGFHLPRRLRRTVLSGQFDVCVDRDFPAIMRACAAPA 93

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWIN  I + +  L  MG++H++E W+   LVGGLYGV+LG  FFGESMFS   +
Sbjct: 94  PGRETTWINSEIYRLFCALHNMGFSHSVECWQNGNLVGGLYGVALGGAFFGESMFSRTTD 153

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L+   F++LD QF T HL +FG  EI   +Y  +LE A+ 
Sbjct: 154 ASKVALVHLVARLRVCGFVVLDTQFGTEHLARFGGEEIPAAEYKAMLEKAVS 205


>gi|258542001|ref|YP_003187434.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633079|dbj|BAH99054.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636136|dbj|BAI02105.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639191|dbj|BAI05153.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642245|dbj|BAI08200.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645300|dbj|BAI11248.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648355|dbj|BAI14296.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651408|dbj|BAI17342.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654399|dbj|BAI20326.1| tRNA(Leu/Phe)-protein transferase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 213

 Score =  167 bits (423), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A    + W  P  RGI+PL+ FH P+RL++ +    +D+ ++  F +V+ ACA   
Sbjct: 21  MASDATDTTLRWYDPDPRGILPLDGFHLPRRLRRTVLSGQFDVCVDRDFPAVMRACAAPA 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWIN  I + +  L  MG++H++E W+   LVGGLYGV+LG  FFGESMFS   +
Sbjct: 81  PGRETTWINSEIYRLFCALHDMGFSHSVECWQNGELVGGLYGVALGGAFFGESMFSRTTD 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV  L+   F++LD QF T HL +FG  EI   +Y  +LE A+ 
Sbjct: 141 ASKLALVHLVARLRLCGFVVLDTQFGTEHLARFGGEEIPAAEYKAMLEKAVS 192


>gi|260575571|ref|ZP_05843569.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodobacter sp. SW2]
 gi|259022214|gb|EEW25512.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodobacter sp. SW2]
          Length = 226

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 103/172 (59%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +   + W+ P  RG++PL+ FH  + L + IRR  Y +  +  F  V+ ACA+  
Sbjct: 21  MAESRDDPQVHWVDPRLRGVLPLDGFHVSQSLARRIRRSGYQVTADRDFAGVVQACAE-- 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  I + Y DL  MG+AH++E W+   L GG+YGV LGA FFGESMFS   +
Sbjct: 79  --RPETWINAPIFQLYADLHRMGHAHSLEVWQDGALAGGVYGVVLGAAFFGESMFSRRTD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            SK+ L HLV  L+   F L D QF+T HL   GA+EI   +Y   L  AL+
Sbjct: 137 GSKLALAHLVARLRAGGFELFDTQFLTPHLASLGAVEIPRAEYRARLAKALQ 188


>gi|89068967|ref|ZP_01156349.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Oceanicola
           granulosus HTCC2516]
 gi|89045548|gb|EAR51612.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Oceanicola
           granulosus HTCC2516]
          Length = 217

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 107/175 (61%), Gaps = 5/175 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++    +I W+ P  RG+ PL+ FH  + L + +RR  Y + I+TAF +V+ ACA + 
Sbjct: 24  MAETRADPEIFWVDPRFRGVFPLDGFHVSRSLARRMRRGGYRVSIDTAFPAVVQACADRE 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKD-VLVGGLYGVSLGAVFFGESMFSHME 119
           +    TWIN TI + Y  LF  G+AH++E W  D  LVGG+YGV+LGA FFGESMFS   
Sbjct: 84  E----TWINDTIYELYEALFESGHAHSLEVWSDDGALVGGVYGVALGAAFFGESMFSRAT 139

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           + SKI L +L+  L+   F L D QF+T HL   GAIEI   +Y   L  AL  P
Sbjct: 140 DGSKIALAYLIDRLRSGGFTLFDTQFLTPHLASLGAIEIPRAEYRTRLARALGRP 194


>gi|99081360|ref|YP_613514.1| leucyl/phenylalanyl-tRNA--protein transferase [Ruegeria sp. TM1040]
 gi|119368211|sp|Q1GGG4|LFTR_SILST RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|99037640|gb|ABF64252.1| Leucyltransferase [Ruegeria sp. TM1040]
          Length = 210

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 104/174 (59%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  ++ W+ P RRGI+PL+ F   + L K +RR+ Y I +N  F  V+  CA + 
Sbjct: 19  MAESRDDPEVFWVDPKRRGILPLDGFRISRSLAKRLRRDDYSISVNRDFAGVVQGCADRE 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I   Y +L + G+AH++E W  D LVGG+YGVSLG  FFGESMFS   +
Sbjct: 79  E----TWINGEIFDRYQELHHDGFAHSLEVWMDDALVGGVYGVSLGGAFFGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASKI L +LV  L    ++L D QFIT HL   G  EI+   Y + L  AL  P
Sbjct: 135 ASKIALAYLVDRLNAGGYILCDTQFITPHLASLGGREISRAAYRRRLAEALDQP 188


>gi|46203515|ref|ZP_00051411.2| COG2360: Leu/Phe-tRNA-protein transferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 218

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 108/171 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RG++PL+ FH P+RL + +R +L+++  +  F++VI  CA   
Sbjct: 19  MAEDADDPTIYWVEPRARGVLPLDRFHVPRRLARTVRSDLFEVVTDRDFDAVIDGCAAPR 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF +G+ HT+E + +  L GGLYGVSLGA FFGESMF  + +
Sbjct: 79  RDTARTWINGRIRDLYGALFDLGHCHTVEVYHQGRLAGGLYGVSLGAAFFGESMFHEVRD 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L++  + L D QFIT HL QFG  E+    Y + L  A+
Sbjct: 139 ASKVALVHLVARLRRGGYRLADTQFITEHLSQFGVEEVPRHVYKRQLSVAI 189


>gi|188580297|ref|YP_001923742.1| leucyltransferase [Methylobacterium populi BJ001]
 gi|179343795|gb|ACB79207.1| Leucyltransferase [Methylobacterium populi BJ001]
          Length = 218

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 108/171 (63%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RG++PL+ FH PKRL + +R +++++  +  F++VI  CA   
Sbjct: 19  MAEDADDPTIYWVEPRARGVLPLDRFHVPKRLARTVRSDVFEVVSDRDFDAVIDGCAAPR 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF +G+ HTIE + +  L GGLYGVSLGA FFGESMF  + +
Sbjct: 79  RDTARTWINARIRDLYGALFDLGHCHTIEVYHEGRLAGGLYGVSLGAAFFGESMFHEVRD 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   F L D QF+T+HL QFG  E+    Y + L  A+
Sbjct: 139 ASKVALVHLVARLRAGGFQLADTQFLTDHLSQFGVEEVPRHIYKRQLAAAI 189


>gi|84499426|ref|ZP_00997714.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanicola batsensis
           HTCC2597]
 gi|84392570|gb|EAQ04781.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanicola batsensis
           HTCC2597]
          Length = 217

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 107/174 (61%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++  +  +I W++P RRGIIPL+ F T + L + +RR+ Y++ IN  F  V+  CA + 
Sbjct: 25  MSEHRDDPEIFWVEPRRRGIIPLDGFRTSRSLSRALRRDDYNVTINRDFTGVLDGCADRD 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I   Y  L   GYAH++E W++  L+GG+YGV+LG  FFGESMFS   +
Sbjct: 85  E----TWISGRIVALYHQLHLSGYAHSLEVWREGALIGGVYGVALGGAFFGESMFSRRTD 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASKI L  LV HL+   F L D QF+T HL   G IE++  +Y   L  AL HP
Sbjct: 141 ASKIALAWLVAHLRNGGFELFDTQFLTPHLASLGGIEVSRAEYRSRLAEALVHP 194


>gi|254485723|ref|ZP_05098928.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter sp.
           GAI101]
 gi|214042592|gb|EEB83230.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter sp.
           GAI101]
          Length = 211

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 104/170 (61%), Gaps = 4/170 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  DI W+ P  RGI PL+ FH  + L + +RR  + I +NTAF  V+  CA + 
Sbjct: 20  MAEHRDDPDIFWVDPRMRGIFPLDGFHISRSLARTMRRTDFSITVNTAFSDVVEGCADRA 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I   Y++L   G AH++E W+   LVGG+YGV+LGA FFGESMFS   N
Sbjct: 80  E----TWINEQIFALYLELHARGSAHSLEVWEGSDLVGGVYGVTLGAAFFGESMFSRRSN 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASKI L  LV  L++  F L D QF+T HL   GAIE+    Y  LL++A
Sbjct: 136 ASKIALACLVDRLRRGGFTLFDTQFLTEHLASLGAIEVPRAAYHDLLDDA 185


>gi|83954274|ref|ZP_00962994.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841311|gb|EAP80481.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfitobacter sp.
           NAS-14.1]
          Length = 192

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  +I W+ P RRG+ PL+ FH  + L + +RR  + I  NTAF  V++ CA   
Sbjct: 1   MAEHRDDPEIFWVDPRRRGVFPLDGFHISRSLARAMRRTRFTITTNTAFNDVVTGCAD-- 58

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I   Y  L  +G+AH +E W+ D+LVGG+YGV+LG  FFGESMFS  +N
Sbjct: 59  --RADTWINAEIFSLYAQLHRLGHAHALEVWEDDMLVGGVYGVTLGRAFFGESMFSRRDN 116

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASKI L  LV  L +  F L D QF+T HL   GA EIT   Y   LE AL
Sbjct: 117 ASKIALACLVDRLNRGGFTLFDTQFLTPHLASLGAQEITRAAYHARLEMAL 167


>gi|149201008|ref|ZP_01877983.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius sp.
           TM1035]
 gi|149145341|gb|EDM33367.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius sp.
           TM1035]
          Length = 213

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 110/172 (63%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++  +  ++ W+ P RRGI+PL+ FH  + L + +R+  Y+  ++  FE+V+  CA + 
Sbjct: 21  MSERRDDPEVFWVDPHRRGILPLDGFHISRSLARRMRQGRYEATLDRDFEAVLRGCADRA 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                TWI+  I +AY+ L   GY H++E W++  LVGG+YGV+LGA FFGESMFS   +
Sbjct: 81  D----TWISPPIHRAYMALHRQGYGHSLEIWQEGHLVGGVYGVALGAAFFGESMFSRRTD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HL  HL    F L D QFIT HL + GA+EI   QY  LLE+A++
Sbjct: 137 ASKLALAHLTDHLALCGFRLFDTQFITPHLGRLGALEIPRTQYRALLEDAME 188


>gi|309791769|ref|ZP_07686257.1| leucyl/phenylalanyl-tRNA/protein transferase [Oscillochloris
           trichoides DG6]
 gi|308226175|gb|EFO79915.1| leucyl/phenylalanyl-tRNA/protein transferase [Oscillochloris
           trichoides DG6]
          Length = 199

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 113/174 (64%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLE-TFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD   +  I W +P  R IIPL+  FH P RL + +R   +++R+++AF  V+ ACA+ 
Sbjct: 23  MADEDGA--IGWYEPRIRAIIPLDDGFHVPSRLARTVRSGRFEVRVDSAFTEVVQACAEP 80

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  I +AY +L  MG AH++E W++  LVGGLYGV+ G +F GESMF    
Sbjct: 81  APGRETTWISGEIVRAYSELHRMGVAHSVECWREGQLVGGLYGVAQGGLFAGESMFHRER 140

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFIT-NHLRQFGAIEITHVQYAKLLENALK 172
           +ASK+ L HLV+ L++  F+LLD QFI   H+ QFG IEI   +Y + L+ AL+
Sbjct: 141 DASKVALVHLVERLRRGGFVLLDSQFIVGGHMLQFGTIEIPRAEYHRRLKGALQ 194


>gi|83949685|ref|ZP_00958418.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius
           nubinhibens ISM]
 gi|83837584|gb|EAP76880.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius
           nubinhibens ISM]
          Length = 215

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 109/174 (62%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++ +  +I W+ P  RGI P++ FH  + + + +RR  Y   +N  F +V+  CA   
Sbjct: 23  MAETRDDPEIFWVDPRERGIFPIDGFHVSRSMARRVRRAEYRATLNQDFAAVVDGCA--- 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN TI+  YI+L  MG+AH++E ++ DVL GG+YGVSLGA FFGESMFS   +
Sbjct: 80  -ARENTWINDTIRGLYIELHNMGHAHSLEIYEGDVLAGGVYGVSLGAAFFGESMFSTRTD 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            SK  L HL+ HL++  F L D QF+T+HL   GA EI+   Y   L +AL+ P
Sbjct: 139 GSKRALLHLIDHLRRCGFHLFDTQFLTDHLASLGAKEISRSDYRSRLASALQMP 192


>gi|84686583|ref|ZP_01014476.1| possible leucyl/phenylalanyl-tRNA--protein transferase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84665496|gb|EAQ11973.1| possible leucyl/phenylalanyl-tRNA--protein transferase
           [Rhodobacterales bacterium HTCC2654]
          Length = 196

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 104/179 (58%), Gaps = 4/179 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A    + W+ P  RGI+PL+ F   + L + IR+  +   ++ AFE V+  CA   
Sbjct: 1   MAEDAGDDTVFWVDPRFRGILPLDGFRLSRSLARTIRKAPFRASLDEAFEGVVEGCAD-- 58

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWIN TI   Y  L  MG AH+IE W+ + LVGG+YGV+LG  FFGESMFS   +
Sbjct: 59  --RETTWINPTIFDGYRKLHAMGRAHSIELWEGEALVGGVYGVTLGRAFFGESMFSRRRD 116

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASKI L  LV HL +  F L D QFIT HL   G IE+   +Y  +LE AL   E   L
Sbjct: 117 ASKIALATLVVHLAQTGFTLFDTQFITKHLATLGGIEVPRARYHAMLEAALSDGEADIL 175


>gi|83943117|ref|ZP_00955577.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfitobacter sp.
           EE-36]
 gi|83846125|gb|EAP84002.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfitobacter sp.
           EE-36]
          Length = 211

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  +I W+ P RRG+ PL+ FH  + L + +RR  + I  NTAF  V++ CA   
Sbjct: 20  MAEHRDDPEIFWVDPRRRGVFPLDGFHISRSLARAMRRTRFTITTNTAFNDVVTGCAD-- 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I   Y  L  +G+AH +E W+ D+LVGG+YGV+LG  FFGESMFS  +N
Sbjct: 78  --RADTWINAEIFSLYGQLHALGHAHALEVWEDDMLVGGVYGVTLGRAFFGESMFSRRDN 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASKI L  LV  L +  F L D QF+T HL   GA EIT   Y   LE AL
Sbjct: 136 ASKIALACLVDRLNRGGFTLFDTQFLTPHLASLGAQEITRAAYHARLEMAL 186


>gi|294678126|ref|YP_003578741.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           capsulatus SB 1003]
 gi|294476946|gb|ADE86334.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           capsulatus SB 1003]
          Length = 212

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 105/173 (60%), Gaps = 4/173 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA + ++ D+ W +P  RG++PL+ FH  + L + I RE Y IR NTAF +V+  CA   
Sbjct: 21  MASARDAADLHWFEPRLRGVVPLQNFHISRSLARVITRETYQIRTNTAFRAVVEGCA--- 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWIN  + + Y  L  +G AH +E W+   LVGG++GV+LG  FFGESMFS   N
Sbjct: 78  -DRPETWINAALFRLYDALHELGAAHAVEVWQGPDLVGGIFGVTLGGAFFGESMFSRAPN 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           ASK+ + + V  L +  F L D Q++T HL+  G +EI  ++Y + L  AL  
Sbjct: 137 ASKVAMAYTVDRLIRGGFSLFDTQYLTPHLQSLGGVEIPRIEYRRRLRVALGQ 189


>gi|296116762|ref|ZP_06835369.1| leucyl/phenylalanyl-tRNA/protein transferase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976684|gb|EFG83455.1| leucyl/phenylalanyl-tRNA/protein transferase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 216

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (60%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A S ++ W  P  RG++PL+ FH P+RL + +    +++  +  F + I ACAQ  
Sbjct: 20  MAPDAGSAELEWYDPPMRGVLPLDGFHVPRRLYRTVMSGRFEVVSDRDFRATIIACAQPA 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I   +  L  MGYAH++EAW+   +VGGLYGVS+G  FFGESMFS   +
Sbjct: 80  PGREQTWINTRIIDLFCALHDMGYAHSVEAWRDGRMVGGLYGVSIGGAFFGESMFSRERD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   + LLD QF T+HL  FG +EI    Y + L +A+
Sbjct: 140 ASKVALVHLVARLRVGGYGLLDTQFGTSHLATFGGLEIPAAHYKRQLGHAI 190


>gi|85704726|ref|ZP_01035827.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius sp. 217]
 gi|85670544|gb|EAQ25404.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius sp. 217]
          Length = 213

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (62%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++  +  D+ W+ P  RGI+PL+ FH  + L + +R+  Y+  +N  FE+V+  CA   
Sbjct: 21  MSEHRDDPDVFWVDPHHRGILPLDGFHISRSLARRMRQGHYEATLNHDFEAVVLGCA--- 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWI+  I +AY+ L   G+ H++E W++  LVGG+YGV+LGA FFGESMFS   +
Sbjct: 78  -DRADTWISPPIHRAYLALHQQGHGHSLEIWQEGQLVGGVYGVALGAAFFGESMFSRRTD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HL  HL +  F L D QFIT HL + G  EI  VQY  LL+ A++
Sbjct: 137 ASKLALAHLTDHLARCGFSLFDTQFITPHLGRLGGREIPRVQYRALLQEAME 188


>gi|84515420|ref|ZP_01002782.1| leucyl/phenylalanyl-tRNA--protein transferase [Loktanella
           vestfoldensis SKA53]
 gi|84510703|gb|EAQ07158.1| leucyl/phenylalanyl-tRNA--protein transferase [Loktanella
           vestfoldensis SKA53]
          Length = 214

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 106/171 (61%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++S +  D+ W+ P RRGI PL+ FH    L + IRR  + +  +TAF  V+  CA + 
Sbjct: 24  MSESRDDPDVFWVDPRRRGIFPLDRFHISHSLTRTIRRGGFRVSFDTAFADVVDGCADRA 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN +I+   I L   G+AH +E W+   LVGG+YG+ +GA FFGESMFS   +
Sbjct: 84  E----TWINPSIRNLSITLHDQGHAHAVEVWQDAQLVGGVYGIRIGAAFFGESMFSRATD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L +L+ +L+   F L D QF+T HL   GA+EIT  QY ++L  A+
Sbjct: 140 ASKVALAYLLHNLRSGGFTLFDTQFLTPHLASLGAVEITRAQYHRMLAAAV 190


>gi|268317883|ref|YP_003291602.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodothermus marinus
           DSM 4252]
 gi|262335417|gb|ACY49214.1| leucyl/phenylalanyl-tRNA/protein transferase [Rhodothermus marinus
           DSM 4252]
          Length = 209

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 108/174 (62%), Gaps = 5/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD  + + I W  P  R I+PL+ FH P+ L + +RR ++ +  + AF+ V++ CA   
Sbjct: 29  MADPEDGR-IYWYAPDPRAILPLDRFHVPRNLARLVRRGVFQVTFDRAFDDVVAVCAD-- 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP TWI   +   Y  L  +G+AH++E W++  LVGGL+GV +G  FFGESMF  +  
Sbjct: 86  --RPQTWIAPALADMYRALHRLGHAHSVECWQEGRLVGGLFGVCIGGAFFGESMFHRVSE 143

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HLV HL+++ F LLDIQF+T H  QFGA EI+   + + L  A+  P
Sbjct: 144 ASKVALVHLVAHLRRQGFRLLDIQFLTPHFHQFGAEEISRADFEQRLAEAVALP 197


>gi|294084610|ref|YP_003551368.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664183|gb|ADE39284.1| leucyl/phenylalanyl-tRNA--protein transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 227

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 105/176 (59%), Gaps = 5/176 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-----FHTPKRLKKYIRRELYDIRINTAFESVISA 55
           MAD+ +S DI +  P  R +IPL+       H P+RL++ +R   +++ I+  F ++I  
Sbjct: 23  MADAHDSDDIRFYDPEVRALIPLDDAVGTGIHIPRRLRRTVRNTPFNVTIDHDFPAIIKG 82

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA+    R  TWIN  IQ  YI L  MG+AH+IE W  D LVGGLYGV+L A FFGESMF
Sbjct: 83  CAELADDRTDTWINKDIQALYIALHKMGFAHSIEVWDGDRLVGGLYGVALRAAFFGESMF 142

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           S   +ASKI L HL+  LK   F LLD QF   HL QFG  EI+   +   L  A+
Sbjct: 143 SRATDASKIALVHLMARLKAGGFQLLDAQFTNPHLVQFGITEISRDTFQDKLAQAM 198


>gi|148656246|ref|YP_001276451.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseiflexus sp.
           RS-1]
 gi|148568356|gb|ABQ90501.1| Leucyltransferase [Roseiflexus sp. RS-1]
          Length = 197

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 112/173 (64%), Gaps = 3/173 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD      I+W  P  R I+PL+ FH P RL + +R+ ++ IR +TAF  V+ ACA   
Sbjct: 18  MADERGV--ITWYDPHPRAILPLDAFHVPHRLARTVRKGVFTIRTDTAFTDVMRACAAPA 75

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R +TWI+  + +AY  L  MG AH++EAW++  LVGGLYGV++  +F GESMFS   +
Sbjct: 76  PGRESTWISEEMIEAYTALHRMGLAHSVEAWREGRLVGGLYGVAIRGLFAGESMFSRERD 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFI-TNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV+ L++  ++LLD QF+ + HL QFG IEI    Y +LL  AL+
Sbjct: 136 ASKVALVHLVERLRRGGYVLLDSQFLGSPHLLQFGLIEIPRRTYKQLLARALQ 188


>gi|156741730|ref|YP_001431859.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseiflexus
           castenholzii DSM 13941]
 gi|156233058|gb|ABU57841.1| Leucyltransferase [Roseiflexus castenholzii DSM 13941]
          Length = 197

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 111/173 (64%), Gaps = 3/173 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD      I W  P  R I+PLE FH P RL + +R+ ++ IR +TAF  V+ ACA+  
Sbjct: 18  MADEHGV--IHWYDPHPRAILPLEAFHVPHRLARTVRKGVFTIRTDTAFTDVMRACAEPA 75

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWI+  +  AY  L  MG+AH++EAW+   LVGGLYGV++  +F GESMFS   +
Sbjct: 76  PGRETTWISEEMIVAYSALHRMGFAHSVEAWRDGRLVGGLYGVAIRGLFAGESMFSRERD 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFI-TNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L HLV+ L++  ++LLD QF+ + HL QFG IEI   +Y + L  AL+
Sbjct: 136 ASKVALVHLVERLRRGGYVLLDSQFLGSPHLLQFGLIEIPRWEYRRRLAQALQ 188


>gi|170749113|ref|YP_001755373.1| leucyltransferase [Methylobacterium radiotolerans JCM 2831]
 gi|170655635|gb|ACB24690.1| Leucyltransferase [Methylobacterium radiotolerans JCM 2831]
          Length = 227

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 108/175 (61%), Gaps = 2/175 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   + W++P  RG++PL+ F  P+RL + +R + + +R +T F+ VI  CA   
Sbjct: 25  MAEDADDPTLYWVEPKARGVLPLDAFRVPRRLARTVRSDQFVVRCDTDFDGVIDGCAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIE--AWKKDVLVGGLYGVSLGAVFFGESMFSHM 118
           +    TWIN  I++ Y  LF +G+ HT+E  A     LVGGLYGVSLGA FFGESMF  +
Sbjct: 85  RDSERTWINGRIRELYGALFDIGHVHTVEVYAGADGRLVGGLYGVSLGAAFFGESMFHEV 144

Query: 119 ENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            +ASK+ L HL+  L+   + L D QF+T HL QFGA E+    Y + L +AL  
Sbjct: 145 RDASKVALVHLMARLRAGGYRLADTQFVTEHLTQFGAEEVPRHVYKRRLADALDQ 199


>gi|254560066|ref|YP_003067161.1| leucyl/phenylalanyl-tRNA-protein transferase [Methylobacterium
           extorquens DM4]
 gi|254267344|emb|CAX23176.1| putative leucyl/phenylalanyl-tRNA-protein transferase
           [Methylobacterium extorquens DM4]
          Length = 235

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 106/171 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RG++PL+ FH PKRL + +R + +++  +  F++VI  CA   
Sbjct: 36  MAEDADDPTIYWVEPRARGVLPLDRFHVPKRLARTVRSDGFEVVSDRDFDAVIEGCAAPR 95

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF +G+ HTIE + +  L GGLYGVSLGA FFGESMF  + +
Sbjct: 96  RDTARTWINARIRDLYGALFDLGHCHTIEVYHEGRLAGGLYGVSLGAAFFGESMFHEVRD 155

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   + L D QF+T HL QFG  E+    Y + L  A+
Sbjct: 156 ASKVALVHLVARLRSGGYRLADTQFLTEHLSQFGVEEMPRHIYKRHLAAAI 206


>gi|240137594|ref|YP_002962065.1| putative leucyl/phenylalanyl-tRNA-protein transferase
           [Methylobacterium extorquens AM1]
 gi|240007562|gb|ACS38788.1| putative leucyl/phenylalanyl-tRNA-protein transferase
           [Methylobacterium extorquens AM1]
          Length = 235

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 106/171 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RG++PL+ FH PKRL + +R + +++  +  F++VI  CA   
Sbjct: 36  MAEDADDPTIYWVEPRARGVLPLDRFHVPKRLARTVRSDGFEVVSDRDFDAVIEGCAAPR 95

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF +G+ HTIE + +  L GGLYGVSLGA FFGESMF  + +
Sbjct: 96  RDTARTWINARIRDLYGALFDLGHCHTIEVYHEGRLAGGLYGVSLGAAFFGESMFHEVRD 155

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   + L D QF+T HL QFG  E+    Y + L  A+
Sbjct: 156 ASKVALVHLVARLRSGGYRLADTQFLTEHLSQFGVEEMPRHIYKRHLAAAI 206


>gi|218529226|ref|YP_002420042.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylobacterium
           chloromethanicum CM4]
 gi|218521529|gb|ACK82114.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylobacterium
           chloromethanicum CM4]
          Length = 224

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 106/171 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RG++PL+ FH PKRL + +R + +++  +  F++VI  CA   
Sbjct: 25  MAEDADDPTIYWVEPRARGVLPLDRFHVPKRLARTVRSDGFEVVSDRDFDAVIEGCAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF +G+ HTIE + +  L GGLYGVSLGA FFGESMF  + +
Sbjct: 85  RDTARTWINARIRDLYGALFDLGHCHTIEVYHEGRLAGGLYGVSLGAAFFGESMFHEVRD 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   + L D QF+T HL QFG  E+    Y + L  A+
Sbjct: 145 ASKVALVHLVARLRSGGYRLADTQFLTEHLSQFGVEEMPRHIYKRHLAAAI 195


>gi|189346092|ref|YP_001942621.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium limicola
           DSM 245]
 gi|226736119|sp|B3EGK5|LFTR_CHLL2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|189340239|gb|ACD89642.1| leucyl/phenylalanyl-tRNA/protein transferase [Chlorobium limicola
           DSM 245]
          Length = 194

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 116/179 (64%), Gaps = 2/179 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D ++ + + W +P  R IIP+E++   + +++ +RR  + +R NT FE VI ACA   
Sbjct: 18  MSDPSDGK-LYWCQPYNRAIIPMESYRPSRDVRRLLRRNDFRVRFNTDFEGVIRACAAPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                TWI+ +I ++Y++L  +G AH++E+W  D L GGLYG+++G  FFGESMF     
Sbjct: 77  PNAVETWISESIIESYLELNRLGIAHSVESWYGDELAGGLYGLAIGGAFFGESMFYRRSY 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           AS+I    LV HL+KR +LLLD Q +  HL++ GA++I H  Y ++L+ AL H +I FL
Sbjct: 137 ASRIAFDRLVMHLRKRGYLLLDAQIMNPHLQKLGAVDIPHKAYMQMLDAAL-HKKIPFL 194


>gi|163850529|ref|YP_001638572.1| leucyltransferase [Methylobacterium extorquens PA1]
 gi|163662134|gb|ABY29501.1| Leucyltransferase [Methylobacterium extorquens PA1]
          Length = 224

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 106/171 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+ A+   I W++P  RG++PL+ FH PKRL + +R + +++  +  F++VI  CA   
Sbjct: 25  MAEDADDPTIYWVEPRARGVLPLDRFHVPKRLARTVRSDGFEVVSDRDFDAVIDGCAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF +G+ HTIE + +  L GGLYGVSLGA FFGESMF  + +
Sbjct: 85  RDTARTWINARIRDLYGALFDLGHCHTIEVYHEGRLAGGLYGVSLGAAFFGESMFHEVRD 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+   + L D QF+T HL QFG  E+    Y + L  A+
Sbjct: 145 ASKVALVHLVARLRSGGYRLADTQFLTEHLSQFGVEEMQRHIYKRHLAAAI 195


>gi|37520603|ref|NP_923980.1| leucyl/phenylalanyl-tRNA--protein transferase [Gloeobacter
           violaceus PCC 7421]
 gi|47115712|sp|Q7NLT7|LFTR_GLOVI RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|35211597|dbj|BAC88975.1| leucyl/phenylalanyl-tRNA-protein transferase [Gloeobacter violaceus
           PCC 7421]
          Length = 193

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+    Q I W +P  R +  L+  H  KRL + IR+E ++IR +TAFE VI ACA   
Sbjct: 21  MAE-GQGQRIYWYEPDPRAVFELDKVHFSKRLLRVIRQERFEIRYSTAFERVIRACAD-- 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             RP+TWI+  I + YI L+  GY  ++E+W    LVGGLYGVSLG  FFGESMF  + +
Sbjct: 78  --RPSTWISEEIIRTYIRLYRTGYGQSVESWLDGELVGGLYGVSLGGAFFGESMFCRVSD 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+   HLV+ L+ R F LLD QF   HL QF  +EI   +Y + L+ AL  P
Sbjct: 136 ASKVAFFHLVERLRGRGFALLDTQFANEHLVQFHVVEIPRREYRQRLKGALALP 189


>gi|163736133|ref|ZP_02143552.1| Leucyltransferase [Phaeobacter gallaeciensis BS107]
 gi|161390003|gb|EDQ14353.1| Leucyltransferase [Phaeobacter gallaeciensis BS107]
          Length = 210

 Score =  161 bits (407), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 106/172 (61%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  ++ W+ P RRGI P+  F   + L K +RR  Y+I +N  F +V+  CA + 
Sbjct: 19  MAESRDDPEVFWVDPKRRGIFPVGGFRLSRSLTKTLRRGEYEIAVNRDFAAVLDGCADRE 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  YIDL   G AH++E +   +L GG+YGV+LG  FFGESMFS   +
Sbjct: 79  E----TWINPEIRARYIDLHNQGNAHSLEVYHAGMLTGGVYGVALGGAFFGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI LT+L+  L++  F L D QF+T HL   GAIEIT   Y + L +AL 
Sbjct: 135 ASKIALTYLMDRLQQTGFTLCDTQFLTPHLASLGAIEITRASYRRQLRDALD 186


>gi|255261527|ref|ZP_05340869.1| leucyl/phenylalanyl-tRNA--protein transferase [Thalassiobium sp.
           R2A62]
 gi|255103862|gb|EET46536.1| leucyl/phenylalanyl-tRNA--protein transferase [Thalassiobium sp.
           R2A62]
          Length = 215

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 107/172 (62%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++  ++ ++ W+ P +RG+ PL+ F   + L++ IR   + I  +T F SV++ CA + 
Sbjct: 23  MSEGRDTDEVFWVDPRKRGVFPLDGFRISRSLRRAIRTSPFRITFDTDFSSVVAGCADRE 82

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I + Y  L   G+AH++E W +  LVGG+YGV++GA FFGESMFS   N
Sbjct: 83  E----TWINGPITRLYAALADAGFAHSVEVWDEQRLVGGVYGVTIGAAFFGESMFSTRTN 138

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L +L+  L+   F+L D QFIT+HL   GAIEI    Y + L  A++
Sbjct: 139 ASKIALAYLIDKLRSSGFVLFDTQFITDHLSSLGAIEIPRGTYRRYLAEAIE 190


>gi|182678916|ref|YP_001833062.1| leucyltransferase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634799|gb|ACB95573.1| Leucyltransferase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 231

 Score =  160 bits (404), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 103/174 (59%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA   ++ W+ P  RGI PL+     K L K IR + +++R++  F++VI  CA + 
Sbjct: 26  MAESAEDPNLFWVDPELRGIFPLDGMIISKSLAKTIRSDRFEVRVDYDFDAVIDQCAAEA 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I+  Y  LF +G  HT+E W++  L+GGLYGV LG  FFGESMF    +
Sbjct: 86  PGRDKTWINARIRLLYRQLFDIGQVHTVETWQEGELIGGLYGVQLGGAFFGESMFHRKTD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L HL   L    F LLD QF+T HL   GAIE+    Y +LL  A+  P
Sbjct: 146 ASKVALAHLAARLIHSGFRLLDTQFVTPHLATLGAIEVPKEAYRRLLAEAITLP 199


>gi|146277493|ref|YP_001167652.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166224670|sp|A4WSI3|LFTR_RHOS5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|145555734|gb|ABP70347.1| Leucyltransferase [Rhodobacter sphaeroides ATCC 17025]
          Length = 214

 Score =  160 bits (404), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  +I W+ P RRGI PL+ FH  + L + IRR  + + +N  F   + ACA + 
Sbjct: 22  MAESRDDPEIHWVDPRRRGIFPLDGFHISRSLARRIRRMDWTVTVNEDFAGTVRACADRD 81

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                TWIN TI + Y+ L  +G+AH++E  + D LVGG+YGV+LG  FFGESMFS   +
Sbjct: 82  D----TWINPTIFRLYVGLHALGHAHSLEVREGDALVGGVYGVTLGRAFFGESMFSRRTD 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L  L+  L+   F L D QF+T HL   GAIEI    Y + L  AL
Sbjct: 138 ASKVALAFLIDRLRAGGFTLFDTQFLTPHLASLGAIEIPRADYHRRLGEAL 188


>gi|87198848|ref|YP_496105.1| leucyl/phenylalanyl-tRNA--protein transferase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|119367705|sp|Q2GA52|LFTR_NOVAD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|87134529|gb|ABD25271.1| Leucyltransferase [Novosphingobium aromaticivorans DSM 12444]
          Length = 263

 Score =  160 bits (404), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 103/172 (59%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS +  ++ W++P  R I+PLE FH  + L + +RR  + +  N AFE+VI ACA   
Sbjct: 25  MADSRDDPEVFWVEPKMRAILPLEGFHLSRSLARTLRRGKFTVTCNAAFEAVIDACAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                +WI+  I+++YI L   G+AH+IE W    LVGGLYGV    VF GESMFS   +
Sbjct: 85  PGAEESWISARIRESYIGLHEHGHAHSIECWHNGRLVGGLYGVGFARVFCGESMFSREPD 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  LV  L+K    LLD QF T HL   GA+EI   QY +LL  A +
Sbjct: 145 ASKVALAWLVASLRKVGAELLDCQFTTPHLASLGAVEIPQSQYLQLLSKAQR 196


>gi|254463724|ref|ZP_05077135.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacterales
           bacterium Y4I]
 gi|206684632|gb|EDZ45114.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacterales
           bacterium Y4I]
          Length = 210

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  ++ W+ P RRGI+PL+ F   + L K IR   ++I +N  F  V+  CA ++
Sbjct: 19  MAEHRDDPEVFWVDPKRRGILPLDGFRISRSLAKRIRNGGFEITVNRDFAGVVEGCADRS 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I+  Y++L  MG AH++E W + VL GG YGVSLG  FFGESMFS   +
Sbjct: 79  E----TWISAGIRDRYLELHTMGNAHSLEVWHQGVLAGGTYGVSLGGAFFGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L +L+  L +  F L D QF+T HL   G IE++  +Y  LL +AL 
Sbjct: 135 ASKVALAYLIDRLVQAGFSLCDTQFLTPHLASLGGIEVSRARYRALLRDALS 186


>gi|217976629|ref|YP_002360776.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylocella
           silvestris BL2]
 gi|217502005|gb|ACK49414.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylocella
           silvestris BL2]
          Length = 229

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 103/171 (60%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA    + W+ P  RG+  L+     K L K IR +++++R++  F++VI  CA   
Sbjct: 26  MAESAEDSSLFWVDPEFRGVFRLDGLIVSKSLAKTIRSDVFEVRVDHDFDAVIDGCAASY 85

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I++ Y  LF  G  HT+E+W+   LVGGLYGV LG  FFGESMF    +
Sbjct: 86  PDREKTWINKRIRRLYRQLFDAGRVHTVESWQDGELVGGLYGVHLGGAFFGESMFHRKTD 145

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+K  F LLD QF+T HL+  GA+EI    Y + L  A+
Sbjct: 146 ASKVALAHLVARLRKGGFSLLDAQFVTPHLQSLGAVEIPKEIYRRRLARAM 196


>gi|163741337|ref|ZP_02148729.1| leucyl/phenylalanyl-tRNA--protein transferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161385690|gb|EDQ10067.1| leucyl/phenylalanyl-tRNA--protein transferase [Phaeobacter
           gallaeciensis 2.10]
          Length = 210

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  ++ W+ P RRGI P+  F   + L K +RR  Y+I +N  F +V+  CA + 
Sbjct: 19  MAESRDDPEVFWVDPKRRGIFPVGGFRLSRSLTKTLRRGEYEIAVNRDFAAVLDGCADRE 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  YIDL   G AH++E +   +L GG+YGV+LG  FFGESMFS   +
Sbjct: 79  E----TWINPEIRARYIDLHNQGNAHSLEVYHAGMLTGGVYGVALGGAFFGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L +L+  L++  F L D QF+T HL   GAIEIT   Y + L +AL 
Sbjct: 135 ASKIALAYLMDRLQQTGFTLCDTQFLTPHLASLGAIEITRASYRRQLRDALD 186


>gi|171912973|ref|ZP_02928443.1| leucyl/phenylalanyl-tRNA--protein transferase [Verrucomicrobium
           spinosum DSM 4136]
          Length = 173

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/163 (44%), Positives = 103/163 (63%), Gaps = 4/163 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           +SW  P  RGI+P+  +H P+ L+  +RR   ++R+NTAF  V+  C Q+ +    TWI+
Sbjct: 8   LSWFSPDPRGILPIREYHVPRSLRAELRRRKIEVRVNTAFGEVLRGCGQRRE----TWIS 63

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I  +Y  L  +GYAH++EAW+ D L+GGLYGV++G  FFGESMFS     SK  L  L
Sbjct: 64  KEIIHSYELLHKLGYAHSVEAWEDDELIGGLYGVAIGGAFFGESMFSRRSGGSKAALVWL 123

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +  L+++QFLL D Q+ T HL  FG  EI   +Y  +LE A+K
Sbjct: 124 MDRLREKQFLLHDTQWTTAHLSMFGGREIAREEYLAILEEAVK 166


>gi|21673185|ref|NP_661250.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium tepidum
           TLS]
 gi|33301299|sp|Q8KFI0|LFTR_CHLTE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|21646265|gb|AAM71592.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium tepidum
           TLS]
          Length = 194

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 113/179 (63%), Gaps = 2/179 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS     +SW +P +R ++PL++F   + L++ I ++ + I+IN+ FE VI AC+Q  
Sbjct: 18  MADSREG-TVSWCQPYQRAVVPLDSFRPSRSLRRVIGKKRFTIKINSVFEQVIRACSQPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                TW++  I K ++ L  +G AH++E+W+   L GGLYG+S+G  FFGESMF    +
Sbjct: 77  STGQETWLSEEIIKVFLKLHRLGVAHSVESWQDGELAGGLYGLSMGGAFFGESMFFFRSD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASK+    LV +LK++ +LLLD Q +  HL   GAIEI H +Y   LE AL   +ISF+
Sbjct: 137 ASKVAFAWLVGYLKRKGYLLLDAQIMNPHLESLGAIEIPHEEYMVQLERALGK-KISFV 194


>gi|77463760|ref|YP_353264.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|119367721|sp|Q3J1H1|LFTR_RHOS4 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|77388178|gb|ABA79363.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 214

 Score =  157 bits (398), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 107/172 (62%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  +I WI P  RGI PL+ FH  + L + IRR  + + ++  F + + ACA + 
Sbjct: 22  MAESRDDPEIHWIDPRHRGIFPLDGFHISRSLARRIRRMDWRVSVDEDFAATVEACADRE 81

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN TI + Y++L  +G+AH++E  + + LVGG+YGV+LG  FFGESMFSH  +
Sbjct: 82  E----TWINPTIFRLYVELHALGHAHSLEVREGETLVGGVYGVTLGRAFFGESMFSHRTD 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  L+  L+   F L D QF+T HL   GAIEI    Y + L  AL+
Sbjct: 138 ASKVALAFLIDRLRAGGFTLFDTQFLTPHLASLGAIEIRRSDYHQRLTEALE 189


>gi|255038173|ref|YP_003088794.1| leucyl/phenylalanyl-tRNA/protein transferase [Dyadobacter
           fermentans DSM 18053]
 gi|254950929|gb|ACT95629.1| leucyl/phenylalanyl-tRNA/protein transferase [Dyadobacter
           fermentans DSM 18053]
          Length = 202

 Score =  157 bits (396), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +IP++T+   K L+  I ++ +DIRI+T FE V+  CA      P TWI+
Sbjct: 27  IYWYSPNPRAVIPIDTYKPSKSLRPVINKKHFDIRIDTDFEGVMRGCALPRASEPGTWIS 86

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I  +Y  L  +GYAH++EAW++  LVGGLYGVS+  VFFGESMF+   NASK+   +L
Sbjct: 87  EEIIASYTALHELGYAHSVEAWREGRLVGGLYGVSINGVFFGESMFTIESNASKVAFHYL 146

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ++ LK  +F LLD QFI +++ ++GAIE+   +Y   L  ALK
Sbjct: 147 IQILKMNRFALLDTQFINDNVLRYGAIEVPRDEYLDQLHKALK 189


>gi|284035360|ref|YP_003385290.1| leucyl/phenylalanyl-tRNA/protein transferase [Spirosoma linguale
           DSM 74]
 gi|283814653|gb|ADB36491.1| leucyl/phenylalanyl-tRNA/protein transferase [Spirosoma linguale
           DSM 74]
          Length = 202

 Score =  156 bits (395), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 113/173 (65%), Gaps = 2/173 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+  +  + W  P  R IIP++T+   K L+  + R  +++RINTAF  V+  C+   
Sbjct: 20  MADADGT--LYWYAPDPRAIIPIDTYKPAKSLRPVLNRNQFEVRINTAFNEVMRNCSIPR 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
               + WI+  I +AY +L +MG AH++E +  D LVGGLYGV+LG+ FFGESMF+ + N
Sbjct: 78  SDDDSVWISEEIIQAYTELHHMGLAHSVETYMDDRLVGGLYGVALGSAFFGESMFNKVSN 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           ASK+   +L+  L++++F LLD QFI +++R++GAIEI    Y K L+ AL+ 
Sbjct: 138 ASKVAFHYLILILRQQRFSLLDTQFINDNVRRYGAIEIPKADYLKQLKAALRQ 190


>gi|126462590|ref|YP_001043704.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|158513440|sp|A3PKR6|LFTR_RHOS1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|126104254|gb|ABN76932.1| Leucyltransferase [Rhodobacter sphaeroides ATCC 17029]
          Length = 214

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 107/172 (62%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  +I WI P  RGI PL+ FH  + L + IRR  + + ++  F + + ACA + 
Sbjct: 22  MAESRDDPEIHWIDPRHRGIFPLDGFHISRSLARRIRRMDWRVSVDEDFAATVEACADRE 81

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN TI + Y++L  +G+AH++E  + + LVGG+YGV+LG  FFGESMFSH  +
Sbjct: 82  E----TWINPTIFRLYVELHALGHAHSLEVREGETLVGGVYGVTLGRAFFGESMFSHRTD 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L  L+  L+   F L D QF+T HL   GAIEI    Y + L  AL+
Sbjct: 138 ASKVALAFLIDRLRAGGFTLFDTQFLTPHLASLGAIEIRRSDYHQRLTVALE 189


>gi|330993817|ref|ZP_08317749.1| Leucyl/phenylalanyl-tRNA--protein transferase [Gluconacetobacter
           sp. SXCC-1]
 gi|329759085|gb|EGG75597.1| Leucyl/phenylalanyl-tRNA--protein transferase [Gluconacetobacter
           sp. SXCC-1]
          Length = 236

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 101/173 (58%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A S  + W  P  RGI+PL+ FH P+RL + +    + +  +  F +++  CA+  
Sbjct: 41  MAPDARSDTLEWFCPEMRGILPLDGFHVPRRLMRTVLSSRFVVATDQDFPAIMDGCAEPA 100

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R +TWIN  I+  +  L  MG+AH++E   +  LVGGLYGV++G  FFGESMFS   +
Sbjct: 101 PGRESTWINPRIRSLFCQLHAMGHAHSVEVRHEGRLVGGLYGVAIGRAFFGESMFSRQRD 160

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           ASK+ L HLV  L+   F LLD QF T HL  FG IEI    Y   LE A++ 
Sbjct: 161 ASKVALVHLVARLRLGGFTLLDTQFGTGHLAGFGGIEIPARAYLHALEQAVEQ 213


>gi|221639631|ref|YP_002525893.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           sphaeroides KD131]
 gi|254809176|sp|B9KJU5|LFTR_RHOSK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|221160412|gb|ACM01392.1| Leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacter
           sphaeroides KD131]
          Length = 214

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 105/171 (61%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  +I WI P  RGI PL+ FH  + L + IRR  + + +N  F + + ACA + 
Sbjct: 22  MAESRDDPEIHWIDPRHRGIFPLDEFHISRSLARRIRRMDWRVGVNEDFAATVEACADRE 81

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN TI + Y++L  +G+AH++E  + + LVGG+YGV+LG  FFGESMFS   +
Sbjct: 82  E----TWINPTIFRLYVELHALGHAHSLEVREGETLVGGVYGVTLGRAFFGESMFSRRTD 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L  L+  L+   F L D QF+T HL   GAIEI    Y + L  AL
Sbjct: 138 ASKVALAFLIDRLRAGGFTLFDTQFLTPHLASLGAIEIRRSDYHQRLTEAL 188


>gi|254474780|ref|ZP_05088166.1| leucyl/phenylalanyl-tRNA--protein transferase [Ruegeria sp. R11]
 gi|214029023|gb|EEB69858.1| leucyl/phenylalanyl-tRNA--protein transferase [Ruegeria sp. R11]
          Length = 211

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  ++ W+ P RRG+ P+  F   + L K IR+  Y++R+N  F +V+  CA + 
Sbjct: 20  MAESRDDPEVFWVDPKRRGVFPIGGFRLSRSLAKTIRKGDYEVRVNHDFAAVVDGCADRE 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  YIDL   G AH++E +    L GG+YGVSL   FFGESMFS   +
Sbjct: 80  E----TWINPEIRDRYIDLHEQGNAHSVEIYHDGDLSGGVYGVSLAGAFFGESMFSRRRD 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L +L+  L+   F+L D QF+T HL   GA+EI+   Y + L +AL+
Sbjct: 136 ASKIALAYLLDRLEISGFILCDTQFLTAHLASLGAVEISRASYRRQLASALE 187


>gi|118572935|sp|Q5FQE8|LFTR_GLUOX RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 225

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 99/171 (57%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A S ++SW  P  RGI+PL   H PK+L + +      +  + AF+ V+ ACA+  
Sbjct: 20  MAPDAGSMELSWYLPEERGIMPLTGMHVPKKLMRLVMSGRMTVTADRAFDEVMRACAEPA 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWI+  I+  Y  L   G AH+IE  + + LVGGLYGVSL   FFGESMFS   +
Sbjct: 80  PGRETTWISGRIRVLYGALHRQGNAHSIEVREGEKLVGGLYGVSLRGAFFGESMFSRERD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+K +F LLD Q+ T HL   G I I    Y  LL  AL
Sbjct: 140 ASKVALVHLVAGLRKGRFTLLDTQYTTPHLTGLGGIGIPAADYQSLLHQAL 190


>gi|58040090|ref|YP_192054.1| leucyl/phenylalanyl-tRNA--protein transferase [Gluconobacter
           oxydans 621H]
 gi|58002504|gb|AAW61398.1| Leucyl/phenylalanyl-tRNA--protein transferase [Gluconobacter
           oxydans 621H]
          Length = 249

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 99/171 (57%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A S ++SW  P  RGI+PL   H PK+L + +      +  + AF+ V+ ACA+  
Sbjct: 44  MAPDAGSMELSWYLPEERGIMPLTGMHVPKKLMRLVMSGRMTVTADRAFDEVMRACAEPA 103

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWI+  I+  Y  L   G AH+IE  + + LVGGLYGVSL   FFGESMFS   +
Sbjct: 104 PGRETTWISGRIRVLYGALHRQGNAHSIEVREGEKLVGGLYGVSLRGAFFGESMFSRERD 163

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L HLV  L+K +F LLD Q+ T HL   G I I    Y  LL  AL
Sbjct: 164 ASKVALVHLVAGLRKGRFTLLDTQYTTPHLTGLGGIGIPAADYQSLLHQAL 214


>gi|254440795|ref|ZP_05054288.1| leucyl/phenylalanyl-tRNA--protein transferase [Octadecabacter
           antarcticus 307]
 gi|198250873|gb|EDY75188.1| leucyl/phenylalanyl-tRNA--protein transferase [Octadecabacter
           antarcticus 307]
          Length = 213

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 70/171 (40%), Positives = 101/171 (59%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+    +D+ W+ P +RG++PL+ FH  + L K +R E + I  +  FE V++ CA + 
Sbjct: 21  MAEHRGDEDLFWVDPRQRGVMPLDGFHISRSLAKTVRSERFTITYDVDFEGVVAGCADRD 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  +   Y  L     A ++E W   VLVGG++G++LG  FFGESMFSH  +
Sbjct: 81  E----TWINEMLVTLYNQLHRARMARSVEVWDNGVLVGGVFGITLGGAFFGESMFSHRTD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+ L +LV  L    F L D QFIT HL   G +E++  QY  +L+ AL
Sbjct: 137 ASKVALAYLVDRLAVGGFELFDTQFITPHLSSLGGVEVSRAQYRHMLDTAL 187


>gi|193213330|ref|YP_001999283.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobaculum parvum
           NCIB 8327]
 gi|226736120|sp|B3QQ80|LFTR_CHLP8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|193086807|gb|ACF12083.1| leucyl/phenylalanyl-tRNA/protein transferase [Chlorobaculum parvum
           NCIB 8327]
          Length = 194

 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 105/171 (61%), Gaps = 1/171 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS     +SW +P +R ++PL+TF   + L++ I    + I+ NTAFE VI ACA   
Sbjct: 18  MADSREGT-VSWCQPYQRAVVPLDTFRPSRSLRRVIDEGQFTIKTNTAFEKVIRACALPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                TWI+  I + ++ L  +G AH++E+W+   L GGLYG+S+G  FFGESMF    +
Sbjct: 77  AVEKETWISEEIIEVFLKLHRLGLAHSVESWQNGELAGGLYGLSMGGAFFGESMFFFERD 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+    LV +L+K+ F LLD Q +  HL   GAIEI H +Y   LE+AL
Sbjct: 137 ASKVAFAWLVGYLRKKGFSLLDAQIMNPHLESLGAIEIPHEEYMLRLEHAL 187


>gi|163746706|ref|ZP_02154063.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanibulbus
           indolifex HEL-45]
 gi|161379820|gb|EDQ04232.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanibulbus
           indolifex HEL-45]
          Length = 211

 Score =  153 bits (387), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 101/170 (59%), Gaps = 4/170 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  +I W+ P RRG++PL  FH  + L + +RR  +   IN  F+ V++ CA   
Sbjct: 20  MAEHRDDPEIFWVDPRRRGVMPLNGFHISRSLARTMRRSSFHHTINRDFDGVVAGCAD-- 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWI+  I   Y  L   G+AH++E W  + LVGG+YGV+LG  FFGESMFS   N
Sbjct: 78  --REDTWISAEIAALYGALHRAGHAHSLEVWDAEALVGGVYGVTLGRAFFGESMFSRRTN 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASK+ L  LV  L++  F+L D QF+T+HL   GA EI+   Y   L+ A
Sbjct: 136 ASKMALAALVDRLRRANFILFDTQFLTDHLASLGAQEISRADYHAQLDVA 185


>gi|126733139|ref|ZP_01748886.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter
           sp. CCS2]
 gi|126716005|gb|EBA12869.1| possible leucyl/phenylalanyl-tRNA--protein transferase [Roseobacter
           sp. CCS2]
          Length = 216

 Score =  153 bits (387), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 103/178 (57%), Gaps = 5/178 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++  N  ++ W+ P  RG+ PL+ F   + L + +RR  + I  +TAF+ V+  CA + 
Sbjct: 24  MSEGRNDPEVFWVDPRMRGVFPLDGFRISRSLARRMRRGGFTIASDTAFQQVVQGCADRD 83

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN TI   Y  L   G AH+IE W    LVGG+YGV++GA FFGESMFS   +
Sbjct: 84  E----TWINETIFDLYCQLHAGGVAHSIEVWNDRDLVGGVYGVTIGAAFFGESMFSRATD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+ L +LV  L+   F L D QFIT HL   GA+EI    Y  +L  AL   E SF
Sbjct: 140 ASKLALAYLVDRLRLGGFQLFDTQFITPHLESLGAVEIPRDHYRAMLMEALAK-EASF 196


>gi|187736455|ref|YP_001878567.1| leucyl/phenylalanyl-tRNA/protein transferase [Akkermansia
           muciniphila ATCC BAA-835]
 gi|226736107|sp|B2UNS0|LFTR_AKKM8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|187426507|gb|ACD05786.1| leucyl/phenylalanyl-tRNA/protein transferase [Akkermansia
           muciniphila ATCC BAA-835]
          Length = 193

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 114/173 (65%), Gaps = 3/173 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD    + IS+ +P  R +IPL+  FH P  LK+ + ++ +++R++TAF  V+ ACA +
Sbjct: 21  MADPETGE-ISFYEPDPRALIPLDDRFHIPHGLKRALNKKPFELRMDTAFPEVVHACA-R 78

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           T +    WI+  I++AY  L  MG+AH++E W ++ L GGLYGV+LG  FFGESMF    
Sbjct: 79  TDQPEEQWIDGQIEEAYGKLHEMGFAHSVECWDEEGLQGGLYGVALGKAFFGESMFHRKT 138

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +ASKI L  LV++L+  +FL LD Q+ T HL +FG  E+   +Y KLL+ AL+
Sbjct: 139 DASKIALVALVQYLRAHRFLFLDTQWTTPHLLKFGTYEVPAKEYRKLLKRALE 191


>gi|85710257|ref|ZP_01041322.1| leu/phe-tRNA-protein transferase [Erythrobacter sp. NAP1]
 gi|85688967|gb|EAQ28971.1| leu/phe-tRNA-protein transferase [Erythrobacter sp. NAP1]
          Length = 239

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 104/183 (56%), Gaps = 5/183 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD    QDI W++P  R IIPL   H  K L+K +R + +++  N AF  V+ ACA   
Sbjct: 25  MADKREDQDIFWVEPRDRAIIPLSGLHVSKSLRKVLRSDRFEVTHNEAFTEVMRACAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAW-----KKDVLVGGLYGVSLGAVFFGESMF 115
              P +WI+  I  +Y  L   G+AH++E W      +  LVGGLYGVS   VF GESMF
Sbjct: 85  PGHPESWISERIVASYTGLHRAGHAHSLECWLTGDAGERRLVGGLYGVSFDKVFCGESMF 144

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           S   NASK+ L  LV  L++  + LLD QF+T+HL   GA+E+    Y  L+E A    E
Sbjct: 145 SLASNASKVALCWLVAMLREAGYQLLDCQFMTDHLASMGAVEMPQKDYLALVEKARGEAE 204

Query: 176 ISF 178
           +S 
Sbjct: 205 LSL 207


>gi|89055208|ref|YP_510659.1| leucyl/phenylalanyl-tRNA--protein transferase [Jannaschia sp. CCS1]
 gi|119367698|sp|Q28NS8|LFTR_JANSC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|88864757|gb|ABD55634.1| Leucyltransferase [Jannaschia sp. CCS1]
          Length = 212

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 99/174 (56%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M++ A++ ++ W+ P RRG+ PL  FH  + L++ IR   Y + IN  F  V+  CA   
Sbjct: 29  MSEGADNPEVFWVDPQRRGVFPLNGFHISRTLRRQIRFGGYSVHINRDFAGVLDGCAD-- 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  +   Y+ L   G AH++E W  + L G ++GV+LGA FFGESMFS    
Sbjct: 87  --REPTWINADLTACYLALHAQGLAHSVEIWDDEGLAGAVFGVTLGAAFFGESMFSRRTG 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            SK+ L HL+  L+   F L D QF+T+HL   GA E+    Y   L +AL+ P
Sbjct: 145 GSKLALAHLIHRLRAGGFTLFDTQFVTDHLMSLGAFELPRSDYRAELSHALQLP 198


>gi|78186344|ref|YP_374387.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium luteolum
           DSM 273]
 gi|119367707|sp|Q3B5N7|LFTR_PELLD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|78166246|gb|ABB23344.1| Leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium luteolum
           DSM 273]
          Length = 194

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 109/172 (63%), Gaps = 1/172 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD+++ Q + W +P  R + PLE++   + + +  RR  Y +  ++ FE+VI ACA   
Sbjct: 18  MADASDGQ-LYWCRPEMRALFPLESYRPSRDVLRLQRRGEYSVFFDSDFEAVIRACAAPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +  P TWI+  I + YI +  +G AH++E   +  L GGLYG+++G  FFGESMF     
Sbjct: 77  KDDPETWISGEIVETYIRIHELGLAHSVECRYRGELAGGLYGIAIGGAFFGESMFYRRSY 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           AS++ L HLV HL+ + +L+LD Q +  HLR+ GA+E+ H +Y +LLE AL+
Sbjct: 137 ASQVALWHLVCHLRLKGYLMLDAQIMNPHLRRLGAVEVPHDEYMRLLEAALR 188


>gi|312129853|ref|YP_003997193.1| leucyl/phenylalanyl-tRNA/protein transferase [Leadbetterella
           byssophila DSM 17132]
 gi|311906399|gb|ADQ16840.1| leucyl/phenylalanyl-tRNA/protein transferase [Leadbetterella
           byssophila DSM 17132]
          Length = 194

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 106/168 (63%), Gaps = 2/168 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD   +  I W +P  R IIP+ ++   K L+  + + +++IR+NTAFE VI  C+   
Sbjct: 18  MADHDGT--IYWYEPDPRAIIPIHSYKPAKSLRPVLNKGIFEIRLNTAFEDVIRQCSLPR 75

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                 WI+  I + Y+DL   G+AH+IEAW    L GGLYGV+LG VFFGESMF  + N
Sbjct: 76  SAEDGVWISEEIIQVYLDLHDYGFAHSIEAWHNGELAGGLYGVALGKVFFGESMFYKVPN 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           ASK+   +L++ LK+R F LLD QFI +++ ++GAIEI    + + LE
Sbjct: 136 ASKVAFHYLIERLKERDFQLLDTQFINDNVLRYGAIEIPKEDFLEQLE 183


>gi|119356512|ref|YP_911156.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium
           phaeobacteroides DSM 266]
 gi|158512599|sp|A1BEA5|LFTR_CHLPD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119353861|gb|ABL64732.1| Leucyltransferase [Chlorobium phaeobacteroides DSM 266]
          Length = 194

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/171 (40%), Positives = 106/171 (61%), Gaps = 1/171 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD  + + + W +P +R ++PL ++   + + + +RR  +++RI++ FE VI  CA   
Sbjct: 18  MADP-DDEKVYWCQPYKRAVVPLLSYMPSRDVARILRRGEFEVRIDSDFEGVIRGCAAPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I  AY+ L  +G AH++E W    L GGLYG+S+GA FFGESMF     
Sbjct: 77  KSDSQTWISPEIMDAYLTLNQLGVAHSVECWHHGELSGGLYGLSMGAAFFGESMFFRRSY 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           AS++   HLV+ LK R +LLLD Q +  HL++ GA+EI H +Y   L+ AL
Sbjct: 137 ASQVAFDHLVRRLKDRGYLLLDAQIMNPHLQKLGAVEIDHDEYMLQLDIAL 187


>gi|144898198|emb|CAM75062.1| Leucyl/phenylalanyl-tRNA--protein transferase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 235

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 106/174 (60%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA +     + WI P  RGI+PL  FH P+ LKK +R+  Y I ++TAF +V+  CA+  
Sbjct: 44  MARTRGDSKLYWIDPEERGILPLPDFHVPRSLKKTLRQGRYRISVDTAFRAVMEGCAEAK 103

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  I   +  L  MG AH++E+W  D LVGGLYG++LG  FFGESMFS   +
Sbjct: 104 TGREDTWINGQIVDLFCQLHAMGLAHSVESWDGDRLVGGLYGLALGGAFFGESMFSRATD 163

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L  LV  LK   FLLLD QFIT HL +FGA EI    Y  LL  AL  P
Sbjct: 164 ASKVALVDLVARLKLGGFLLLDTQFITEHLSRFGATEIPRHHYKLLLAAALNEP 217


>gi|86605348|ref|YP_474111.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           JA-3-3Ab]
 gi|119368213|sp|Q2JWL1|LFTR_SYNJA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|86553890|gb|ABC98848.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           JA-3-3Ab]
          Length = 192

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 105/175 (60%), Gaps = 6/175 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD   +  ++W    +  +IPL E FH P+ L+  +R   + +RIN AFE V+  CA  
Sbjct: 19  MADE-ETGSLAWYGTEQHALIPLDERFHCPRSLRPLVRGSCFQVRINGAFEQVVEGCA-- 75

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              RP TWI+  +++ Y+ L   G+AH+ E W+ D L GG+ G++LGA F GESMF  + 
Sbjct: 76  --ARPQTWISSELKQIYLALHQAGFAHSFETWQGDTLAGGILGIALGAAFIGESMFYRIP 133

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           NASK+ L  LV+HL++R F L D Q +  HL +FGA  +    Y +LL+  L+ P
Sbjct: 134 NASKVALVKLVEHLRERGFRLFDAQLMNPHLARFGAFLMDGRDYQELLQQCLRIP 188


>gi|194334485|ref|YP_002016345.1| leucyl/phenylalanyl-tRNA--protein transferase [Prosthecochloris
           aestuarii DSM 271]
 gi|226737707|sp|B4S3F9|LFTR_PROA2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|194312303|gb|ACF46698.1| leucyl/phenylalanyl-tRNA/protein transferase [Prosthecochloris
           aestuarii DSM 271]
          Length = 194

 Score =  150 bits (378), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 110/179 (61%), Gaps = 2/179 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M D  +  ++ W +P RR + PL+T+   + +++ +R  ++DI+IN  F +VI+ CA+  
Sbjct: 18  MGDP-DDGNVYWCRPRRRAVFPLDTYRASRVVRRLVRDNVFDIQINRDFNAVIAHCAKPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I   Y++L  +G AH++E +    L GGLYG++LG  FFGESMF    N
Sbjct: 77  RHESETWISDEIVAVYLELHSLGLAHSVECYADGELAGGLYGIALGGAFFGESMFFRQPN 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           ASK+    LV+ LK ++F LLD Q +  HL   GA+EI H +Y + L  AL+  +ISFL
Sbjct: 137 ASKVAFDALVRQLKLQRFDLLDAQIMNPHLEFLGAVEIDHEEYMRQLAMALEK-KISFL 194


>gi|149186416|ref|ZP_01864729.1| leu/phe-tRNA-protein transferase [Erythrobacter sp. SD-21]
 gi|148830005|gb|EDL48443.1| leu/phe-tRNA-protein transferase [Erythrobacter sp. SD-21]
          Length = 227

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 103/167 (61%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD  + +++ W++P  R IIPL+  H  K L+K +R++ + +  +  F  VI+ACA+  
Sbjct: 25  MADHRSDREVYWVEPRERAIIPLDGLHVSKSLRKILRQDRFRVSCDENFARVIAACAEPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           ++   +WI+  I+ +YI L   G+AH++E W+   LVGGLYGV+   VF GESMFS   N
Sbjct: 85  EELAESWISHQIEASYIALHKAGHAHSVEVWQSGELVGGLYGVAFDRVFCGESMFSRTAN 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           ASK+ L  LV  +++  + LLD QF+T HL   GA+ +    Y  LL
Sbjct: 145 ASKVALAWLVAAMRRAGYALLDCQFMTEHLGSMGAVAMPQSAYLGLL 191


>gi|159043943|ref|YP_001532737.1| leucyltransferase [Dinoroseobacter shibae DFL 12]
 gi|189046553|sp|A8LJB4|LFTR_DINSH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|157911703|gb|ABV93136.1| leucyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 223

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 102/172 (59%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA++ +   + W+ P +RG++PL+  H  ++L++++ R  + + +N  F  V++ CA + 
Sbjct: 29  MAEARDDDAVFWVDPRQRGVLPLDGVHVSRKLRRFLARTEWTLSLNQDFAGVVAGCADRD 88

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I  AY  L  MG+AH +E  +   L+GG+YGV++G  FFGESMFS   N
Sbjct: 89  E----TWINDQIFDAYTALHAMGFAHALEVREDGALIGGVYGVAIGTAFFGESMFSRRPN 144

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            SK+ L  L  HL++  + L D QF+T HL   GA+EI+   Y   L  AL 
Sbjct: 145 GSKVALVALCAHLRRCGYTLFDTQFVTPHLATMGAVEISRDSYRAQLRAALS 196


>gi|77919853|ref|YP_357668.1| leucyl/phenylalanyl-tRNA--protein transferase [Pelobacter
           carbinolicus DSM 2380]
 gi|119367706|sp|Q3A2A9|LFTR_PELCD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|77545936|gb|ABA89498.1| leucyl/phenylalanyl-tRNA--protein transferase [Pelobacter
           carbinolicus DSM 2380]
          Length = 230

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 103/172 (59%), Gaps = 2/172 (1%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR- 63
           N+ D I W  P  R ++ L  F+  + L K +RR  Y++  + AF  VI ACA+  +K  
Sbjct: 48  NADDPILWWSPDPRCVLALSAFYLNRSLSKELRRGRYEVTFDKAFSEVIRACARTPRKEG 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           P TWI   + KAY  L  +GYAH++EAW +  LVGGLYGV+LG  FFGESMF  M NASK
Sbjct: 108 PGTWITGDMLKAYELLHGLGYAHSVEAWYEGCLVGGLYGVALGGCFFGESMFHCMPNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           +    LV+HL    + L+D Q  + HL   GA E+   ++ +LL+NA  HP 
Sbjct: 168 VAFATLVRHLAMLGYHLIDCQQSSRHLLSMGATEVPRAEFLQLLQNAGVHPS 219


>gi|260432986|ref|ZP_05786957.1| leucyl/phenylalanyl-tRNA--protein transferase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416814|gb|EEX10073.1| leucyl/phenylalanyl-tRNA--protein transferase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 210

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 106/170 (62%), Gaps = 4/170 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  N  ++ W+ P  RG+ PL+ FH  + L++ IR   + + +N  F +V+  CA   
Sbjct: 19  MAEHRNDPELFWVDPRLRGVFPLDGFHISRSLRRRIRNCGFSVTVNRDFPAVVDGCA--- 75

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  +++ Y  L   G+AH++E W+ D LVGG++GV+LGA FFGESMFS   +
Sbjct: 76  -DRADTWINDQLRQLYAQLHKTGHAHSLELWEGDALVGGVFGVTLGAAFFGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASKI L +LV  L++  F L D QF+T HL   GAIEI   +Y +LL+ A
Sbjct: 135 ASKIALAYLVDRLRQTGFQLFDTQFLTAHLASLGAIEIPRHEYRRLLDQA 184


>gi|260426163|ref|ZP_05780142.1| leucyl/phenylalanyl-tRNA--protein transferase [Citreicella sp.
           SE45]
 gi|260420655|gb|EEX13906.1| leucyl/phenylalanyl-tRNA--protein transferase [Citreicella sp.
           SE45]
          Length = 211

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/171 (39%), Positives = 101/171 (59%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  ++ W+ P RRGI+P+   H  + + + +RR+ Y I ++  F  VI  CA + 
Sbjct: 19  MAEHRDDPELFWVDPRRRGILPIRGLHISRSMARRLRRDDYRITVDADFAGVIDGCADRR 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  +++L   G AH++E W  D L GG+YG+ +GA F GESMFS   +
Sbjct: 79  E----TWINQEIRALFLELHDRGLAHSLEVWMDDKLAGGIYGLEIGAAFCGESMFSRRRD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASKI L  ++  L++  F L D QF+T HL   G IEIT   Y   L++AL
Sbjct: 135 ASKIALCWMLDLLREAGFTLFDTQFLTEHLASMGGIEITRTDYRARLQDAL 185


>gi|85375051|ref|YP_459113.1| leucyl/phenylalanyl-tRNA--protein transferase [Erythrobacter
           litoralis HTCC2594]
 gi|84788134|gb|ABC64316.1| leu/phe-tRNA-protein transferase [Erythrobacter litoralis HTCC2594]
          Length = 242

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 101/170 (59%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS + Q++ W++P  R IIP+  F   + L + +RRE + +  +  FE+V+  CA+  
Sbjct: 38  MADSRHDQEVFWVEPRDRAIIPIGGFRCSRSLARTLRRERFTVTYDRDFEAVVRGCAEPR 97

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
              P +WI+  I  +Y DL   G+AH+IE W+   LVGG+YGV+   VF GESMFS   +
Sbjct: 98  PDHPESWISERIIASYRDLHAAGHAHSIECWQDGELVGGVYGVAFDRVFCGESMFSRERD 157

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASK+ L  L+  L++    L D QF+T HL   GA+E+    Y + LE A
Sbjct: 158 ASKVALAWLMALLERAGCELFDCQFMTGHLASLGAVELPQADYLQKLEAA 207


>gi|254453539|ref|ZP_05066976.1| leucyl/phenylalanyl-tRNA--protein transferase [Octadecabacter
           antarcticus 238]
 gi|198267945|gb|EDY92215.1| leucyl/phenylalanyl-tRNA--protein transferase [Octadecabacter
           antarcticus 238]
          Length = 193

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 100/172 (58%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  + + + W+ P +RGI+PL+ FH  + L K IR + + I  +  F  V++ CA   
Sbjct: 1   MAEHRSDEGLFWVDPRQRGILPLDGFHISRSLAKSIRSDRFTITYDFDFAGVVTGCAN-- 58

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  +   Y  L     AH++E W   VLVGG++G++LG  FFGESMFSH  +
Sbjct: 59  --REETWINDMLMTLYNQLHRARAAHSVEVWDNGVLVGGVFGIALGGAFFGESMFSHRTD 116

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK+ L +LV  L    F L D QFIT HL   G +E++  +Y K L  AL+
Sbjct: 117 ASKVALAYLVDRLAVGGFDLFDTQFITPHLASLGGVEVSRARYRKRLRAALE 168


>gi|326329310|ref|ZP_08195635.1| leucyltransferase [Nocardioidaceae bacterium Broad-1]
 gi|325952885|gb|EGD44900.1| leucyltransferase [Nocardioidaceae bacterium Broad-1]
          Length = 242

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 113/177 (63%), Gaps = 7/177 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M   ++   + W  P++RG++PL+     + L++ +R   ++IRI+T+F+ V+++CA   
Sbjct: 58  MPGESSRDPMMWFSPVKRGVLPLDGLVVSRSLRRSVRD--FEIRIDTSFDEVVASCADP- 114

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +RP  WI+  I++AY +L  +G+AH++EAW+   LVGGLYGV++G +F GESMF  + +
Sbjct: 115 -RRPHGWIDKRIRRAYGNLHRLGWAHSVEAWQDGRLVGGLYGVAIGGLFAGESMFHRVRD 173

Query: 121 ASKICLTHLVKHLKKRQFL---LLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L  LV  L++   +   +LD+Q+ T+HL   G +EI    Y   LE AL+ P
Sbjct: 174 ASKVALVGLVSALREAGSIDQRILDVQWRTDHLASLGVVEIDRNDYLDRLEKALRLP 230


>gi|86608385|ref|YP_477147.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|119368214|sp|Q2JMZ3|LFTR_SYNJB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|86556927|gb|ABD01884.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 192

 Score =  147 bits (371), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 103/175 (58%), Gaps = 6/175 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD   +  ++W    R  +IPL E FH P+ L+  +R   + +R+N AFE V+  CA  
Sbjct: 19  MADE-ETGSLAWYGTGRHAVIPLDERFHCPRSLRPLVRSGRFQVRLNCAFEQVVEGCA-- 75

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              RP TWI+  +++ Y  L   G+AH+ E W+ + L GG+ G++LGA F GESMF  + 
Sbjct: 76  --ARPQTWISPELKQIYAALHRSGFAHSFETWQGETLAGGILGIALGAAFIGESMFYRIP 133

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           N SK+ L  LV+HL++R F L D Q +  HL +FGA  +   +Y KLL+  L  P
Sbjct: 134 NGSKVALVKLVEHLRERGFRLFDAQLMNPHLARFGAFLMDGQEYLKLLQQCLGIP 188


>gi|326386497|ref|ZP_08208120.1| leucyl/phenylalanyl-tRNA--protein transferase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209158|gb|EGD59952.1| leucyl/phenylalanyl-tRNA--protein transferase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 280

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 103/180 (57%), Gaps = 5/180 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MADS +  +I W++P  R I+PL  FH    L + +RR  + +  NTAF++VI  CA   
Sbjct: 25  MADSRDDPEIYWVEPKIRAILPLNRFHLSHSLARTLRRGRFRVTCNTAFDAVIDHCAAPR 84

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMF 115
                +WI+  I+++Y +L  +G AH+IE W  D      LVGGLYGV    VF GESMF
Sbjct: 85  PDAEQSWISARIRESYRELHRLGAAHSIETWITDADGEERLVGGLYGVGFARVFCGESMF 144

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           S + +ASK+ L  LV  L+     LLD QF T HL   G +E+    Y  LL ++++ PE
Sbjct: 145 SRVSDASKVALAWLVAALRMGGGELLDCQFSTPHLESLGTVELPQGDYLALLRHSIRPPE 204


>gi|153870676|ref|ZP_02000025.1| leucyl/phenylalanyl-tRNA--protein transferase [Beggiatoa sp. PS]
 gi|152072854|gb|EDN69971.1| leucyl/phenylalanyl-tRNA--protein transferase [Beggiatoa sp. PS]
          Length = 195

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 102/169 (60%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P +R ++  +     + L+K IR+  + + ++  F  VI  CA   +K+  
Sbjct: 9   DDQPILWWSPAQRMVLLPDDLKVSRSLRKTIRKAKFTVTLDQNFRGVIKECAGSRRKQHG 68

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +QKAY  L   G+AH++E W +  LVGGLYG++LG VFFGESMFSH+ +ASK+ 
Sbjct: 69  TWITEEMQKAYYQLHIQGFAHSVECWYEGRLVGGLYGIALGKVFFGESMFSHLTDASKVA 128

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            TH V  L++  + L+D Q  TNHL+  GAIEI   +Y  LL+   + P
Sbjct: 129 FTHFVWQLQRWGYELIDCQVKTNHLQSLGAIEIPRPKYRVLLDRLCETP 177


>gi|332173686|gb|AEE22940.1| leucyl/phenylalanyl-tRNA/protein transferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 234

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 101/170 (59%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++++ I W  P  RGI+PLE F+  K LKK+IR+  + + +NT F  VI ACA  T++  
Sbjct: 51  SSNEPILWWSPDPRGILPLENFNVSKSLKKFIRKTPFRVTVNTQFAQVIYACANVTRQSS 110

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AYI+L   GYA +IE W  + LVGGLYGV+ G +F GESMF +  NASK+
Sbjct: 111 GTWITDEMINAYIELHRSGYAQSIEVWDDETLVGGLYGVTPGNLFCGESMFHYATNASKL 170

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            + +LV+ L++     +D Q    HL   G IEI    +   L+  +K P
Sbjct: 171 AMFYLVELLRQNGSEFIDCQLQNEHLESLGCIEIPRTAFLSKLKAVVKEP 220


>gi|302185006|ref|ZP_07261679.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. syringae 642]
          Length = 229

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 97/169 (57%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKVLRQSRYRVTFDEDFVSVIQACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q+AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQEAYVELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LVKHL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVKHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|189499758|ref|YP_001959228.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium
           phaeobacteroides BS1]
 gi|189495199|gb|ACE03747.1| leucyl/phenylalanyl-tRNA/protein transferase [Chlorobium
           phaeobacteroides BS1]
          Length = 197

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 104/171 (60%), Gaps = 1/171 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M D  + + + W +P  R ++PLE++   + +    RR  +D+ +N  FE VI +CA+  
Sbjct: 21  MGDPEDGK-VYWCQPRMRAVVPLESYRPSRVVAGLTRRSAFDVCVNRDFEKVIRSCAEPR 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I + ++ L + G+AH++E ++ + +VGGLYG++LG  FFGESMF    N
Sbjct: 80  KNEKETWISEEIIEVFMALHHHGFAHSVECYRGEEIVGGLYGIALGGAFFGESMFYRQPN 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASK+    L+ HLK + + LLD Q +  HL   GA+EI H  Y +LL +AL
Sbjct: 140 ASKVAFDWLISHLKIKGYELLDAQIMNPHLASLGAVEIEHTVYMELLLHAL 190


>gi|330954580|gb|EGH54840.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           Cit 7]
          Length = 229

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (58%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI+ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKVLRQLRYRVTFDQDFASVITACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q+AYI+L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQEAYIELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL +  F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTEWGFVLIDCQMPTQHLHSFGARAIPRQTFADYLSRHLDQP 219


>gi|159899720|ref|YP_001545967.1| leucyl/phenylalanyl-tRNA--protein transferase [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|226737699|sp|A9B6X1|LFTR_HERA2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|159892759|gb|ABX05839.1| Leucyltransferase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 191

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 99/164 (60%), Gaps = 5/164 (3%)

Query: 10  ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           I W  P  R IIPL E FH    L++ IRR+ ++IR +TAF   + AC++    R  TWI
Sbjct: 27  IYWYDPDPRAIIPLDERFHVSSSLQRTIRRQTFEIRFDTAFRETMQACSE----RDETWI 82

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +    + Y  L   G AH++EAW+   +VGGLYGV L  +F GESM+S   +ASK+ L  
Sbjct: 83  SQEFIEIYSQLHAGGLAHSVEAWQDGEMVGGLYGVGLAGLFAGESMWSKARDASKVALVA 142

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           LV+ L+   F LLD QFIT HL  FGA EI   +Y +LL  AL+
Sbjct: 143 LVERLRAGGFQLLDTQFITPHLATFGAYEIPRAEYKQLLVKALQ 186


>gi|198282564|ref|YP_002218885.1| leucyl/phenylalanyl-tRNA/protein transferase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|198247085|gb|ACH82678.1| leucyl/phenylalanyl-tRNA/protein transferase [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 239

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (60%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  RGI+     H  + L+K  R   +  R+++ F  VI ACA     +  TWI 
Sbjct: 60  ILWWSPDPRGILEPPAIHVSRSLRKSARNRDWQYRMDSNFAGVIDACAAPRPGQGDTWIT 119

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY+DLF  G AH+IE +++D LVGGLYGV+LG +FFGESMFS + +AS++ L  L
Sbjct: 120 PAVRAAYLDLFAAGAAHSIEVYQQDRLVGGLYGVALGGLFFGESMFSRVPDASRLALVLL 179

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            +HL+   F L+D QFIT HL+  GA EI    + + L +
Sbjct: 180 ARHLQHWGFGLIDTQFITPHLQSMGAREIPRRDFLRALAD 219


>gi|218666174|ref|YP_002424755.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|218518387|gb|ACK78973.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 241

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (60%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  RGI+     H  + L+K  R   +  R+++ F  VI ACA     +  TWI 
Sbjct: 62  ILWWSPDPRGILEPPAIHVSRSLRKSARNRDWQYRMDSNFAGVIDACAAPRPGQGDTWIT 121

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY+DLF  G AH+IE +++D LVGGLYGV+LG +FFGESMFS + +AS++ L  L
Sbjct: 122 PAVRAAYLDLFAAGAAHSIEVYQQDRLVGGLYGVALGGLFFGESMFSRVPDASRLALVLL 181

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            +HL+   F L+D QFIT HL+  GA EI    + + L +
Sbjct: 182 ARHLQHWGFGLIDTQFITPHLQSMGAREIPRRDFLRALAD 221


>gi|289679168|ref|ZP_06500058.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. syringae FF5]
          Length = 229

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKVLRQSRYRVTFDQDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQAAYVELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTDWGFVLIDCQMPTQHLHSFGARAIPRQTFADYLSRHLDQP 219


>gi|330981389|gb|EGH79492.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 198

 Score =  144 bits (362), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 20  DGQPILWWSPDPRTVLFPEELHVSRSLGKVLRQSRYRVTFDQDFASVIKACAAPRSYANE 79

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 80  TWITGSMQAAYVELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 139

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 140 FATLVEHLTDWGFVLIDCQMPTQHLHSFGARAIPRQTFADYLSRHLDQP 188


>gi|257485421|ref|ZP_05639462.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289625409|ref|ZP_06458363.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289649308|ref|ZP_06480651.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|330866854|gb|EGH01563.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330889675|gb|EGH22336.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330987925|gb|EGH86028.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. lachrymans str. M301315]
 gi|331010743|gb|EGH90799.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 229

 Score =  144 bits (362), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|66046409|ref|YP_236250.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. syringae B728a]
 gi|75501536|sp|Q4ZRL0|LFTR_PSEU2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|63257116|gb|AAY38212.1| Leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. syringae B728a]
 gi|330972891|gb|EGH72957.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 229

 Score =  144 bits (362), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHISRSLAKVLRQSRYRVTFDQDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQAAYVELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTAWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|330900608|gb|EGH32027.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. japonica str. M301072PT]
          Length = 229

 Score =  143 bits (361), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEEIHVSRSLGKVLRQSRYRVTFDQDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQAAYVELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FAMLVEHLTDWGFVLIDCQMPTQHLHSFGARAIPRQTFADYLSRHLDQP 219


>gi|108803917|ref|YP_643854.1| leucyl/phenylalanyl-tRNA--protein transferase [Rubrobacter
           xylanophilus DSM 9941]
 gi|119367722|sp|Q1AX36|LFTR_RUBXD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|108765160|gb|ABG04042.1| Leucyltransferase [Rubrobacter xylanophilus DSM 9941]
          Length = 191

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 102/156 (65%), Gaps = 5/156 (3%)

Query: 18  RGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYI 77
           R ++ L+  H  K L + +R+ +Y++RI+  FE+VI ACA + +    TWI+  I +A++
Sbjct: 34  RAVLELDALHVSKSLARVLRKGVYEVRIDQDFEAVIRACADREE----TWISEEIIRAFL 89

Query: 78  DLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKR 136
            L   G AH++EA+  +  L GGLYGV+LG  FFGESMFS   +ASK+CL  LV+ L++R
Sbjct: 90  GLHRRGLAHSVEAYDGEGRLAGGLYGVALGGAFFGESMFSRRPDASKVCLVRLVERLRER 149

Query: 137 QFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            ++LLD Q  + HL + GA+EI   ++ + L  AL+
Sbjct: 150 GYVLLDCQVQSPHLERMGAVEIPEAEFMRRLSEALR 185


>gi|88812892|ref|ZP_01128136.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrococcus mobilis
           Nb-231]
 gi|88789814|gb|EAR20937.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrococcus mobilis
           Nb-231]
          Length = 250

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 99/170 (58%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q + W  P  R II   + H  + L+K +R++ Y + ++  F++VI AC+   Q + 
Sbjct: 54  SEEQPVLWWSPDPRLIIYPRSLHASRSLRKRLRQQDYQLTMDQCFQAVIEACSTPRQGQA 113

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I+ AY +L   G AH++E W+  +LVGGLYGVSLGA FFGESMFS   +ASKI
Sbjct: 114 GTWITPEIRAAYWELHRRGIAHSVEVWRAGLLVGGLYGVSLGAAFFGESMFSRATDASKI 173

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L  L   L    F  +D Q  T HL   G +EI+  ++ + L+ AL +P
Sbjct: 174 ALAWLAAQLDAWSFHFIDCQLPTPHLHALGGVEISRCRFIRELDAALAYP 223


>gi|212703190|ref|ZP_03311318.1| hypothetical protein DESPIG_01232 [Desulfovibrio piger ATCC 29098]
 gi|212673456|gb|EEB33939.1| hypothetical protein DESPIG_01232 [Desulfovibrio piger ATCC 29098]
          Length = 247

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 96/164 (58%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++PL+ F  P+R  + +R   +++R++TAF  VI ACA   +    TWI   
Sbjct: 55  WWCPDPRCVLPLDAFQLPRRSARALRNHPFELRMDTAFSRVIRACAAPRRDGEGTWILPE 114

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +  AY  L  +GYAH++EAW+   L+GGLYGV+LG  FFGESMF     AS+  L  LV 
Sbjct: 115 MIAAYERLHALGYAHSVEAWRDGELLGGLYGVALGRAFFGESMFHRCPEASRAALAGLVA 174

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
            L+ R FLLLD Q  T H+   GA +I   ++  LL  A+  P+
Sbjct: 175 FLRGRDFLLLDCQQATPHMLAMGARDIPRKEFLGLLRQAVPVPD 218


>gi|302130347|ref|ZP_07256337.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato NCPPB 1108]
          Length = 229

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 95/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q I W  P  R ++  E  H  + L K +R+  Y +  +T F  VI ACA        
Sbjct: 51  EGQPILWWSPDPRTVLLPEELHISRSLGKVLRQSRYRVTFDTDFARVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLARHLDQP 219


>gi|284028144|ref|YP_003378075.1| leucyl/phenylalanyl-tRNA/protein transferase [Kribbella flavida DSM
           17836]
 gi|283807437|gb|ADB29276.1| leucyl/phenylalanyl-tRNA/protein transferase [Kribbella flavida DSM
           17836]
          Length = 221

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/165 (41%), Positives = 101/165 (61%), Gaps = 6/165 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  PL RG+I +  F   + L++   R  Y+IR+NTAF+ VI ACA    +RP +WI+  
Sbjct: 55  WWSPLERGVIEVAGFAPSRSLRRA--RNRYEIRVNTAFDQVIRACADP--RRPGSWIDRD 110

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           I ++Y  L  MG+ H++EAW  D L GGLYGV++G +F GESMF H  + SK  +  LV+
Sbjct: 111 IIESYTRLHRMGWVHSVEAWDGDELAGGLYGVAIGGLFAGESMFHHKTDGSKAAVAGLVE 170

Query: 132 HLKKRQFL--LLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L  +     + DIQ++T+HL   GA+ I   QY + ++ AL+ P
Sbjct: 171 LLDDKYAAERVFDIQWVTDHLATLGAVSIPRDQYVRRVQRALELP 215


>gi|28870514|ref|NP_793133.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213970051|ref|ZP_03398183.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato T1]
 gi|301381406|ref|ZP_07229824.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato Max13]
 gi|302058404|ref|ZP_07249945.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato K40]
 gi|33301273|sp|Q87ZS4|LFTR_PSESM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|28853762|gb|AAO56828.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213925155|gb|EEB58718.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. tomato T1]
 gi|331017255|gb|EGH97311.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 229

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 95/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q I W  P  R ++  E  H  + L K +R+  Y +  +T F  VI ACA        
Sbjct: 51  EGQPILWWSPDPRTVLLPEELHISRSLGKVLRQSRYRVTFDTDFARVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +D LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLARHLDQP 219


>gi|254461973|ref|ZP_05075389.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacterales
           bacterium HTCC2083]
 gi|206678562|gb|EDZ43049.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 215

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 105/172 (61%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S +  ++ W+ P RRGIIP+  FH  + L +++R   + IRINT F+ V++ACA+  
Sbjct: 24  MAESRDDSELFWVDPRRRGIIPINDFHISRSLARHMRSANWTIRINTDFDGVVAACAE-- 81

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWI+  I + Y  L  M  AH++E W++  LVGG+YGV  G  FFGESMFS   +
Sbjct: 82  --REDTWISHNIARLYSSLHQMAQAHSLEIWEESDLVGGVYGVVAGTAFFGESMFSKRRD 139

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASK  L  L KHL    F L D QF+T+HL   GAIEI+   Y   L  AL+
Sbjct: 140 ASKTALAFLTKHLSNCGFTLFDTQFLTDHLATLGAIEISRADYHTQLHEALQ 191


>gi|70731241|ref|YP_260982.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           fluorescens Pf-5]
 gi|68345540|gb|AAY93146.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           fluorescens Pf-5]
          Length = 245

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 100/171 (58%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R ++  +  H  + L K +R++ Y +  +  F +VISACA       
Sbjct: 69  SEGQPILWWSPDPRTVLFPDELHVSRSLGKLLRKQHYQVTFDRDFAAVISACAAPRAYAD 128

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  +Q+AY+ L   GYAH++E W + VLVGGLYG+++G +FFGESMFS  +NASK 
Sbjct: 129 GTWISEAMQRAYLQLHQRGYAHSVEVWDQGVLVGGLYGLAMGQLFFGESMFSRADNASKF 188

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
               LV+ LK   F+L+D Q  T HL   GA  I+  ++A  L++ L  P 
Sbjct: 189 GFATLVERLKAWGFVLIDCQMPTEHLHSLGARSISRPEFANYLKHHLDLPS 239


>gi|254423111|ref|ZP_05036829.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           PCC 7335]
 gi|196190600|gb|EDX85564.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           PCC 7335]
          Length = 192

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 99/170 (58%), Gaps = 5/170 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLE-TFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           A+ + ++W    +R IIPL+  F  PK L++ + ++ +   IN +FE+VI  CA     R
Sbjct: 22  ADGKTLNWYSSNQRAIIPLDHRFRYPKSLQRVLNQKRFTPAINRSFEAVIDGCA----DR 77

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
            TTWI+  ++K Y+ L   GYAH+ E W+ D L GG  G+ LG VF GESMF  +   SK
Sbjct: 78  DTTWISPQLKKIYMQLHRAGYAHSFETWQGDELAGGFLGICLGGVFIGESMFYRIPEGSK 137

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             +  LV HL+ RQF L D+Q +  HL +FGA EI    Y   L NA++ 
Sbjct: 138 AAMVMLVNHLRSRQFTLFDVQILNPHLARFGAFEIDRAVYEATLYNAIQQ 187


>gi|118572940|sp|Q4K9V1|LFTR_PSEF5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 226

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 100/170 (58%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R ++  +  H  + L K +R++ Y +  +  F +VISACA       
Sbjct: 50  SEGQPILWWSPDPRTVLFPDELHVSRSLGKLLRKQHYQVTFDRDFAAVISACAAPRAYAD 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  +Q+AY+ L   GYAH++E W + VLVGGLYG+++G +FFGESMFS  +NASK 
Sbjct: 110 GTWISEAMQRAYLQLHQRGYAHSVEVWDQGVLVGGLYGLAMGQLFFGESMFSRADNASKF 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               LV+ LK   F+L+D Q  T HL   GA  I+  ++A  L++ L  P
Sbjct: 170 GFATLVERLKAWGFVLIDCQMPTEHLHSLGARSISRPEFANYLKHHLDLP 219


>gi|298487533|ref|ZP_07005575.1| Leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298157917|gb|EFH98995.1| Leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 229

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W ++ LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQNELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSGHLDQP 219


>gi|312961670|ref|ZP_07776168.1| Leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           fluorescens WH6]
 gi|311283929|gb|EFQ62512.1| Leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           fluorescens WH6]
          Length = 286

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 95/170 (55%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R +I  +  H  + L K +R++ Y +  +  F +VI ACA       
Sbjct: 110 SQGQPILWWSPDPRTVIFPDELHVSRSLGKLLRQQRYRVTFDQDFAAVIQACAAPRAYAD 169

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY++L   GYAH++E W  D LVGGLYG+++G +FFGESMFS  +NASK 
Sbjct: 170 GTWITEGIQNAYLELHKRGYAHSVEVWDDDRLVGGLYGLAMGRLFFGESMFSRADNASKF 229

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               LV  LK   F+L+D Q   +HL   GA  I   ++A LL+  L  P
Sbjct: 230 GFATLVGQLKAWGFVLIDCQMPNDHLHSLGARAIPRSEFAGLLQEHLDQP 279


>gi|330810446|ref|YP_004354908.1| Leucyltransferase (leucyl phenylalanyl-tRNA-protein transferase)
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327378554|gb|AEA69904.1| Leucyltransferase (leucyl phenylalanyl-tRNA-protein transferase)
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 226

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 97/170 (57%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R ++  +  H  + L K +R++ Y++  +  F +VI ACA       
Sbjct: 50  SEGQPILWWSPDPRTVLFPDELHISRSLGKLLRKQRYEVTFDRDFAAVIQACAAPRDYAE 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +Q AY++L   G+AH++E W +  LVGGLYG+++G +FFGESMFS  +NASK 
Sbjct: 110 GTWITDAMQTAYLELHRRGFAHSVEVWDQGALVGGLYGLAMGQLFFGESMFSRADNASKF 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               LV+HLK   F+L+D Q  T HL   GA  I   ++A  L+  L  P
Sbjct: 170 GFARLVQHLKAAGFVLIDCQMPTEHLHSLGARSIPRTEFAGYLKAHLDQP 219


>gi|126656223|ref|ZP_01727607.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp.
           CCY0110]
 gi|126622503|gb|EAZ93209.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp.
           CCY0110]
          Length = 193

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/177 (39%), Positives = 104/177 (58%), Gaps = 7/177 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +   + W    +R +IPL E F  PK LK+++ + ++ + +N  F  V   CA  
Sbjct: 21  MADENDV--LGWYSSRQRALIPLDERFRYPKSLKRFLNQNIFSVAVNRDFLGVCQGCA-- 76

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R +TWI   + + Y  L   GYAH+ E W+ D L GG+ G+++GA F GESMF  + 
Sbjct: 77  --DRDSTWIAPELIEIYYQLHLAGYAHSFETWQGDKLAGGILGITIGAAFIGESMFFRIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           N SK+ +  LV+HLK R F+L D Q   +HL +FG+  I+ ++Y KLL+ AL +P I
Sbjct: 135 NGSKVAMVKLVEHLKSRGFILFDAQLQNDHLARFGSYLISDLEYQKLLQEALSYPCI 191


>gi|119714421|ref|YP_921386.1| leucyl/phenylalanyl-tRNA--protein transferase [Nocardioides sp.
           JS614]
 gi|119535082|gb|ABL79699.1| Leucyltransferase [Nocardioides sp. JS614]
          Length = 227

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 102/176 (57%), Gaps = 6/176 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M        ++W  P+RRG++PL+     + L++  R   ++IRI+TAF+ V++ CA   
Sbjct: 21  MPSGRPGDPMAWFCPVRRGVVPLDGLRVSRSLRRATRD--FEIRIDTAFDQVVAGCADP- 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            +R   WI+  +  AY  L  +G+AH++EAW+   L GGLYGV++G +F GESMF    +
Sbjct: 78  -RRSGGWIDEEVGAAYAALHQLGWAHSVEAWRHGRLAGGLYGVAIGGLFAGESMFHRQRD 136

Query: 121 ASKICLTHLVKHLKKRQFL--LLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK+ L  LV+ L        LLD+Q++T HL   GA+E+    Y + L  AL  P
Sbjct: 137 ASKVALVALVEALNDEWTADRLLDVQWLTPHLASLGAVEVPRPTYLRRLARALPLP 192


>gi|320327912|gb|EFW83917.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330881207|gb|EGH15356.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 229

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W ++ LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQNELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|71736010|ref|YP_275264.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|119367708|sp|Q48H69|LFTR_PSE14 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|71556563|gb|AAZ35774.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 229

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W ++ LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQNELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|109898686|ref|YP_661941.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudoalteromonas
           atlantica T6c]
 gi|123064522|sp|Q15TA1|LFTR_PSEA6 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|109700967|gb|ABG40887.1| Leucyltransferase [Pseudoalteromonas atlantica T6c]
          Length = 234

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 102/171 (59%), Gaps = 1/171 (0%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           SAN + I W  P  RGI+PL+ F   K L+K+IR+    + +N  F+ VI ACA+  ++ 
Sbjct: 51  SAN-EPILWWSPDPRGILPLDNFSVSKSLRKFIRKTPLRVTVNRRFDEVIYACAKVKRQS 109

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +  AYI+L   G AH+IE W  + LVGGLYGV+ G VF GESMF +  NASK
Sbjct: 110 SGTWITDDMINAYIELHRCGGAHSIEVWDDEELVGGLYGVTPGNVFCGESMFHYATNASK 169

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           + + +LV+ L+      +D Q   +HL   G IE+   ++   L+ A+KHP
Sbjct: 170 LAMFYLVELLRLNGCEFIDCQLQNDHLASLGCIEMPRAEFLNRLKEAVKHP 220


>gi|56478219|ref|YP_159808.1| leucyl/phenylalanyl-tRNA--protein transferase [Aromatoleum
           aromaticum EbN1]
 gi|81598636|sp|Q5P1A7|LFTR_AZOSE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|56314262|emb|CAI08907.1| Leucyl/phenylalanyl-tRNA--protein transferase [Aromatoleum
           aromaticum EbN1]
          Length = 237

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 98/164 (59%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q I W  P  R ++        + L++ +R++ +++R +TAF  VI+ACA+  +    
Sbjct: 50  EDQPILWWSPDPRLVLIPAHLRISRSLRRTLRQQRFEVRFDTAFADVIAACAEPREPGGG 109

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI+  I++AY+ L  +GYAH++E+W    LVGGLYG++LG  FFGESMFS   +ASK+ 
Sbjct: 110 TWISPEIRQAYLRLHELGYAHSVESWVDGTLVGGLYGIALGRAFFGESMFSRRSDASKVA 169

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           L HL  HL++  F  +D Q  T HL   GA E+   ++   L N
Sbjct: 170 LVHLAAHLQRLGFAAIDCQMTTAHLLSLGAEEMPRARFCAGLAN 213


>gi|320323772|gb|EFW79856.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. glycinea str. B076]
          Length = 229

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W ++ LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQNELVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|77459809|ref|YP_349316.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           fluorescens Pf0-1]
 gi|119367710|sp|Q3KA79|LFTR_PSEPF RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|77383812|gb|ABA75325.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudomonas
           fluorescens Pf0-1]
          Length = 226

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 99/170 (58%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R ++  +  H  + L K +R++ Y +  +  F++VI ACA   +   
Sbjct: 50  SEGQPILWWSPDPRTVLFPDELHVSRSLGKLMRKQRYRVTFDQDFDAVIRACAAPREYAD 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +Q AYI+L   G+AH++E W +  LVGGLYG+++G +FFGESMFS  +NASK 
Sbjct: 110 GTWITEAMQDAYIELHRRGFAHSVEVWDEGELVGGLYGLAMGQLFFGESMFSRADNASKY 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               LV+HL++  F+L+D Q  T+HL   GA  I+   +A  L   L  P
Sbjct: 170 GFATLVQHLREAGFVLIDCQMPTDHLHSLGARAISRQTFADYLARHLDQP 219


>gi|104781336|ref|YP_607834.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           entomophila L48]
 gi|122403640|sp|Q1IBD5|LFTR_PSEE4 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|95110323|emb|CAK15030.1| leucyl, phenylalanyl-tRNA--protein transferase [Pseudomonas
           entomophila L48]
          Length = 226

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 100/169 (59%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K+IR+  Y +  ++ F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHISRSLAKFIRQGHYQVSFDSDFPAVIEACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  +++ AY +L   G+AH++E  ++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITDSMRAAYCELHRRGFAHSVEVRREGELVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HLK+  F+L+D Q  TNHL   GA  I+  ++A  L   L  P
Sbjct: 171 FVALVEHLKQAGFVLIDCQMPTNHLHSLGARAISRAEFADHLARHLDQP 219


>gi|88703369|ref|ZP_01101085.1| Leucyl/phenylalanyl-tRNA--protein transferase [Congregibacter
           litoralis KT71]
 gi|88702083|gb|EAQ99186.1| Leucyl/phenylalanyl-tRNA--protein transferase [Congregibacter
           litoralis KT71]
          Length = 236

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 98/166 (59%), Gaps = 4/166 (2%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q + W  P  R I+PLE  H  + L+K +RR+   + I+ AF  V+ ACA     +  TW
Sbjct: 54  QPVLWWTPDPRSILPLEDLHVSRSLRKTLRRDALTLSIDKAFADVMEACAAPRDGQRGTW 113

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  + +AY  L   G+AH+IE W++  LVGGLYGV++G  FFGESMFS   +ASKI L 
Sbjct: 114 IDRDMIQAYHRLSEEGHAHSIEVWREGTLVGGLYGVAIGGAFFGESMFSRETDASKIALV 173

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            LV  L+KR  + +D Q  + HL   GA  ++ V +    EN L+H
Sbjct: 174 ALVWVLRKRGAVFIDCQIESEHLNSLGARNVSRVDF----ENRLQH 215


>gi|194337236|ref|YP_002019030.1| leucyl/phenylalanyl-tRNA/protein transferase [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|226737705|sp|B4SDP5|LFTR_PELPB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|194309713|gb|ACF44413.1| leucyl/phenylalanyl-tRNA/protein transferase [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 194

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 106/172 (61%), Gaps = 1/172 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D  + + + W +P +R +  L+++   + + +  R++ + + ++  F  VI  CA   
Sbjct: 18  MSDPEDEK-VYWCQPYKRAVFCLDSYRPSRDVLRLTRKKEFTVTLDKEFAGVIKGCAAPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWI+  I +AY  L  +G AH+ E+W +  LVGGLYG++LG  FFGESMFS    
Sbjct: 77  KNDHETWISDEIIEAYTKLHSLGIAHSFESWYQGELVGGLYGIALGGAFFGESMFSRRSY 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           AS+I   HLV HL+++ +LLLD Q +  HL++ GA+EI H +Y + L +AL+
Sbjct: 137 ASRIAFDHLVFHLREKGYLLLDAQIMNPHLQRLGAVEIEHEEYMRQLAHALQ 188


>gi|310816206|ref|YP_003964170.1| possible leucyl/phenylalanyl-tRNA--protein transferase
           [Ketogulonicigenium vulgare Y25]
 gi|308754941|gb|ADO42870.1| possible leucyl/phenylalanyl-tRNA--protein transferase
           [Ketogulonicigenium vulgare Y25]
          Length = 211

 Score =  140 bits (354), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 97/162 (59%), Gaps = 4/162 (2%)

Query: 9   DISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           ++ W+ P  RG++P+   H  + L + +R  LY +  +TAF+ V+  CA +++    TWI
Sbjct: 28  ELFWVDPDMRGLLPIGGLHISRSLARRMRSGLYHVTFDTAFDLVMEGCADRSE----TWI 83

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           N  I + Y  L  +G+AH++E W+ D LVGG YGV++G  FFGESMFS   +ASK+ L +
Sbjct: 84  NPEIFRLYKGLRDIGHAHSVEVWQGDTLVGGCYGVAIGGAFFGESMFSRATDASKVALAY 143

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           L+  L++  F L D QF+T HL   G  E+    Y   L+ A
Sbjct: 144 LIDRLRRSGFTLFDTQFLTPHLASLGGYELPRHSYRLRLQAA 185


>gi|110596831|ref|ZP_01385121.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium
           ferrooxidans DSM 13031]
 gi|110341518|gb|EAT59978.1| leucyl/phenylalanyl-tRNA--protein transferase [Chlorobium
           ferrooxidans DSM 13031]
          Length = 194

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 111/179 (62%), Gaps = 2/179 (1%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MAD  + +   W +P +R +  LE +   + +++ +R++ + + ++  F+ VIS CA   
Sbjct: 18  MADPDDGK-TYWCRPHKRALFSLEAYRPSRDVQRLLRKKEFSVTLDRDFDGVISGCAAPR 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +  P TWI+  I + Y  L+ +G AH++E+  +  LVGGLYG+++G  FFGESMFS    
Sbjct: 77  KNDPETWISTEIIEVYRKLYRLGLAHSVESRYQGELVGGLYGLAIGGAFFGESMFSLRSY 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           AS++    LV HL+ + +LLLD Q +  HLR+ GA+EI H ++   L++AL+  +I FL
Sbjct: 137 ASRVAFDRLVYHLRMKGYLLLDAQIMNPHLRKLGAVEIEHEEFMVQLDHALRK-KIVFL 194


>gi|255022246|ref|ZP_05294240.1| Leucyl/phenylalanyl-tRNA--protein transferase [Acidithiobacillus
           caldus ATCC 51756]
 gi|254968302|gb|EET25870.1| Leucyl/phenylalanyl-tRNA--protein transferase [Acidithiobacillus
           caldus ATCC 51756]
          Length = 243

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 96/163 (58%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  RG++     H  + L+K  RR  +++ I+  F  V++ CA     +  TWI 
Sbjct: 61  ILWWSPDPRGVLFPAAVHGSRSLRKSARRGGWELAIDRDFAGVVAGCAMPRADQDGTWIT 120

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  LF  GYAH+ E +    LVGGLYGV+LG VFFGESMFS   +ASK  L  L
Sbjct: 121 ADMALAYQTLFRAGYAHSFEVYAGRDLVGGLYGVALGGVFFGESMFSRARDASKWALYAL 180

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            +HL+   F L+D QF+T HL++ GA+E++  ++ +LL  AL 
Sbjct: 181 ARHLEAWGFCLIDTQFLTAHLQRMGAVELSRFEFLRLLRLALS 223


>gi|254284308|ref|ZP_04959276.1| leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium NOR51-B]
 gi|219680511|gb|EED36860.1| leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium NOR51-B]
          Length = 225

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 95/165 (57%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q + W  P  R ++    FH  + L+K +R+  + +R ++AF  V+  CA      P TW
Sbjct: 28  QPVLWWTPDPRAVLFPNEFHCSRSLRKTLRKNQFSVRCDSAFADVVERCAAPRADSPDTW 87

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  ++ AY  L  +G AH+IE W+ D LVGGLYGV +G VFFGESMFS   + SKI L 
Sbjct: 88  ISPQMKAAYCHLHALGCAHSIETWRGDQLVGGLYGVRIGDVFFGESMFSAQPDTSKIALA 147

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            LV   +K    L+D Q    HL   GA EI   ++ KLL++A+K
Sbjct: 148 GLVWLAQKAGLKLIDCQVTNPHLLGLGAREIPRKRFEKLLQDAIK 192


>gi|46580014|ref|YP_010822.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120602575|ref|YP_966975.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           vulgaris DP4]
 gi|52783126|sp|Q72BN2|LFTR_DESVH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|158513908|sp|A1VDN2|LFTR_DESVV RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|46449430|gb|AAS96081.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120562804|gb|ABM28548.1| Leucyltransferase [Desulfovibrio vulgaris DP4]
 gi|311233987|gb|ADP86841.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           vulgaris RCH1]
          Length = 234

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 100/172 (58%), Gaps = 1/172 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
                I W  P  R ++PL+  H P+RL + +R + +++R++TAF  V+  CA   +  +
Sbjct: 49  GPGDPILWWSPDPRCVLPLDALHVPRRLMRTVRAKTFEVRLDTAFADVLEQCAATPRPGQ 108

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TW+   ++ AY  L ++G+AH++EAW    LVGGLYGV+LG  FFGESMF  M +ASK
Sbjct: 109 GGTWLVPEMRAAYTRLHHLGHAHSVEAWYGGRLVGGLYGVALGGGFFGESMFHAMPDASK 168

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           +    L + L    F  +D Q  T+H+ +FGA+E+    +   L +A + P 
Sbjct: 169 VAFVWLARLLVSWGFRFVDCQQTTSHMLRFGAVEMPRTDFLACLHDATRQPS 220


>gi|189219568|ref|YP_001940209.1| Leu/Phe-tRNA-protein transferase [Methylacidiphilum infernorum V4]
 gi|189186426|gb|ACD83611.1| Leu/Phe-tRNA-protein transferase [Methylacidiphilum infernorum V4]
          Length = 220

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 91/158 (57%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             + ++W  P  R I  +ETF  P+RL + IR+  +   IN  F  VI  CA+    R  
Sbjct: 48  TDRPLTWWSPDPRAIFEIETFKPPRRLAQKIRQGKFQFTINQCFSEVIKNCAKPAPGREH 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI+    KAY +L   GYAH++E W K +LVGGLYGV++G  F GESMF  + +ASK  
Sbjct: 108 TWISPRFIKAYTELHRYGYAHSVEVWAKGMLVGGLYGVAIGGFFAGESMFHRITDASKAA 167

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           L   V HLK+R F+L D Q  T   R  GA++I   +Y
Sbjct: 168 LAFTVAHLKERGFVLFDTQVATPVTRLMGAVDIPRSEY 205


>gi|330875793|gb|EGH09942.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 229

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +T F  VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHISRSLGKVLRQCRYRVTFDTDFARVIRACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W ++ LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQDAYLELHRRGHAHSVEVWDQEELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|330965612|gb|EGH65872.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 229

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +T F  VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHISRSLGKVLRQCHYRVTFDTDFARVIRACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W ++ LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGSMQNAYLELHRRGHAHSVEVWDQEELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVEHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQP 219


>gi|313498106|gb|ADR59472.1| Aat [Pseudomonas putida BIRD-1]
          Length = 226

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 96/170 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K IR+  Y +  +T F +VI+ACA        
Sbjct: 51  DGQPILWWSPDPRTVLLPDQLHVSRSLAKLIRKGRYQVSFDTDFPAVIAACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  T++ AY +L   G AH++E  +   LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITDTMRNAYCELHRRGIAHSVEVRQDGELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
              LV HL+   F+L+D Q  TNHL   GA  I+  ++A  L   L  P 
Sbjct: 171 FVTLVNHLRDAGFVLIDCQMPTNHLHSLGAHAISRAEFASYLARHLDQPN 220


>gi|262199101|ref|YP_003270310.1| leucyl/phenylalanyl-tRNA/protein transferase [Haliangium ochraceum
           DSM 14365]
 gi|262082448|gb|ACY18417.1| leucyl/phenylalanyl-tRNA/protein transferase [Haliangium ochraceum
           DSM 14365]
          Length = 233

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 5/168 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---T 66
           I W  P  R ++     H  + L+K +RR+ Y++R+++AFE VI AC+     RP    T
Sbjct: 53  ILWHSPDPRMVLTPGALHVGRSLRKQMRRQPYELRLDSAFEQVIDACS--IIDRPGQDGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   ++ AY++L   G+AH+ EAW  D LVGGLYGVSLG  FFGESMF+   +ASKI  
Sbjct: 111 WITSEMRDAYLELHRRGFAHSAEAWAGDELVGGLYGVSLGGAFFGESMFARAPDASKIAF 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV+ L      L+D Q  T HL +FGA E +   + + L  A++ P
Sbjct: 171 VALVRQLGAWGIELIDCQVHTEHLERFGADEWSRPAFLRALAQAMRAP 218


>gi|317153520|ref|YP_004121568.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316943771|gb|ADU62822.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 236

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 97/152 (63%), Gaps = 1/152 (0%)

Query: 24  ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINMTIQKAYIDLFYM 82
           + FH P+ L++ + R ++   ++TAFE+VI ACA   + ++  TWI   +  AYI L  +
Sbjct: 67  DRFHLPRSLRQVLNRGVFTFSMDTAFEAVIRACAASPRPEQRGTWIVPEMVDAYIRLHEL 126

Query: 83  GYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLD 142
           GYAH++EAW+   L GG+YGVS+G+ FFGESMF  + +ASK     LV  L +  F L+D
Sbjct: 127 GYAHSVEAWRDGELAGGVYGVSIGSAFFGESMFHTVPDASKAAFATLVAQLVRWDFTLID 186

Query: 143 IQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            Q  T HL++FGA+E+   ++  LL  A+ HP
Sbjct: 187 CQQTTPHLQRFGAVEVQRFRFRALLREAISHP 218


>gi|158522491|ref|YP_001530361.1| leucyltransferase [Desulfococcus oleovorans Hxd3]
 gi|158511317|gb|ABW68284.1| Leucyltransferase [Desulfococcus oleovorans Hxd3]
          Length = 269

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 99/174 (56%), Gaps = 1/174 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR- 63
           A    I W  P  R ++        +RL + +R++ + + ++ AFE V+ ACA   ++  
Sbjct: 64  AEGDPILWWSPDPRLVLFPGDLRISRRLGRVLRKKPFQVTMDAAFEQVVRACAAAPRRSG 123

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           P TWI   +  AY  L   GYAH++EAW++  L GGLYGVSLG  FFGESMF+   NASK
Sbjct: 124 PGTWIVDEMIDAYCRLHRAGYAHSVEAWQEGELAGGLYGVSLGRCFFGESMFTRTSNASK 183

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             L  LV+ L  R F ++D Q  T HL  FGA+EI+   + K L  AL  P ++
Sbjct: 184 AALVRLVQFLSDRGFDMIDCQMTTAHLVGFGAVEISRKLFLKRLAAALMAPTLT 237


>gi|225851235|ref|YP_002731469.1| leucyl/phenylalanyl-tRNA--protein transferase [Persephonella marina
           EX-H1]
 gi|225646268|gb|ACO04454.1| leucyl/phenylalanyl-tRNA--protein transferase [Persephonella marina
           EX-H1]
          Length = 227

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 106/169 (62%), Gaps = 1/169 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++  E     + LKK +++ ++ +R +TAFE VI+ CA   +K  
Sbjct: 47  SEDEPILWWCPDPRMVLFPEKLRISRSLKKTLKKNIFTVRFDTAFEEVINRCATVERKDQ 106

Query: 65  T-TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           T TW+   +  AYI L  +GYAH++E +  + LVGGLYGVSLG VFFGESMF  + +ASK
Sbjct: 107 TGTWLVPEMIDAYIRLHSLGYAHSVEVYLGNRLVGGLYGVSLGGVFFGESMFHEVSDASK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +   HLV+ LK+  F ++D Q  T HLR+FGA +I+  Q+  +L  +LK
Sbjct: 167 VAFVHLVQKLKEWDFDMIDCQQSTEHLRRFGAEDISRKQFLDILRLSLK 215


>gi|223936985|ref|ZP_03628893.1| leucyl/phenylalanyl-tRNA/protein transferase [bacterium Ellin514]
 gi|223894266|gb|EEF60719.1| leucyl/phenylalanyl-tRNA/protein transferase [bacterium Ellin514]
          Length = 217

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 96/164 (58%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + ++W  P  RG++ L+ FH  K L K +++ L+ I  + AF+ V+  CA+    R TTW
Sbjct: 48  KPVTWWSPDPRGVMELDRFHVSKSLGKTLKKGLFRITRDRAFKEVMEGCAEAAPGRRTTW 107

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I      AY  L   GYAH++E W++  LVGG+YGV++G  F GESMF    +ASK+ L 
Sbjct: 108 ITPEFINAYTRLHERGYAHSLECWQERKLVGGIYGVAMGGFFAGESMFRRANDASKVALY 167

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           +L +HL+ R F L DIQ IT   +  G I I+   Y K L  ++
Sbjct: 168 YLTEHLQNRGFTLFDIQTITPTTKHLGGISISREDYLKRLAQSV 211


>gi|145219319|ref|YP_001130028.1| leucyl/phenylalanyl-tRNA--protein transferase [Prosthecochloris
           vibrioformis DSM 265]
 gi|145205483|gb|ABP36526.1| Leucyltransferase [Chlorobium phaeovibrioides DSM 265]
          Length = 195

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 100/171 (58%), Gaps = 1/171 (0%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           M+D  + + + W +P  R + PL+ F   + +++  R+ ++ + +N  F  VI  CA   
Sbjct: 19  MSDPEDGE-LYWCRPHMRAVFPLDRFSPSRDVRRLERKGVFRLTVNHDFPGVIRGCAAPR 77

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +  P TWI+  I  AY  L  +G AH+IE W    L GGLYG+S+   FFGESMFS    
Sbjct: 78  KGDPDTWISEPIIAAYQQLHELGLAHSIECWHDGELAGGLYGMSMAGAFFGESMFSWRSY 137

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           AS++ L+ LV  L+ + F LLD Q +  HLR+ GA+EI+H +Y + L  AL
Sbjct: 138 ASQVALSFLVHRLRLKGFRLLDAQIMNPHLRRLGAVEISHEEYMEQLAVAL 188


>gi|26990710|ref|NP_746135.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas putida
           KT2440]
 gi|148547063|ref|YP_001267165.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas putida
           F1]
 gi|33301276|sp|Q88FS7|LFTR_PSEPK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166224669|sp|A5W1H1|LFTR_PSEP1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|24985703|gb|AAN69599.1|AE016593_7 leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas putida
           KT2440]
 gi|148511121|gb|ABQ77981.1| Leucyltransferase [Pseudomonas putida F1]
          Length = 226

 Score =  138 bits (347), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R+  Y +  +T F +VI+ACA        
Sbjct: 51  DGQPILWWSPDPRTVLLPDQLHVSRSLAKLMRQGRYQVSFDTDFPAVIAACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  T++ AY +L   G AH++E  +   LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITDTMRNAYCELHRRGIAHSVEVRQDGELVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
              LV HL+   F+L+D Q  TNHL   GA  I+  ++A  L   L  P 
Sbjct: 171 FVTLVNHLRDAGFVLIDCQMPTNHLHSLGAHAISRAEFASYLARHLDQPN 220


>gi|115374936|ref|ZP_01462208.1| leucyl/phenylalanyl-tRNA--protein transferase [Stigmatella
           aurantiaca DW4/3-1]
 gi|310819209|ref|YP_003951567.1| leucyl/phenylalanyl-tRNA-protein transferase [Stigmatella
           aurantiaca DW4/3-1]
 gi|115368063|gb|EAU67026.1| leucyl/phenylalanyl-tRNA--protein transferase [Stigmatella
           aurantiaca DW4/3-1]
 gi|309392281|gb|ADO69740.1| Leucyl/phenylalanyl-tRNA-protein transferase [Stigmatella
           aurantiaca DW4/3-1]
          Length = 227

 Score =  138 bits (347), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 101/173 (58%), Gaps = 5/173 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q + W  P  R ++  +  H  + L+K ++   Y++R +TAFE VISAC++    RP
Sbjct: 50  SEGQPLLWHSPNPRFVLEPDKLHVGRSLRKTMKAGTYEVRWDTAFEQVISACSET--PRP 107

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   + +AY+ L ++G+AH++EAW    L GGLYGVSLGA FFGESMF+H  +A
Sbjct: 108 GQNGTWITDAMLEAYVTLHHLGFAHSVEAWADGELKGGLYGVSLGAAFFGESMFAHAPDA 167

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           SK+     V+ LK   F  +D Q  T HL +FGA      ++   L  AL+ P
Sbjct: 168 SKVAFATSVERLKAWGFHFIDCQVETEHLARFGAEPWPRRRFLGALAQALEEP 220


>gi|331004977|ref|ZP_08328387.1| Leucyl/phenylalanyl-tRNA-protein transferase [gamma proteobacterium
           IMCC1989]
 gi|330421219|gb|EGG95475.1| Leucyl/phenylalanyl-tRNA-protein transferase [gamma proteobacterium
           IMCC1989]
          Length = 234

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 102/170 (60%), Gaps = 2/170 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK--TQK 62
           +  + I W  P  R II ++  H  + L+K I++  + I  + AF  V+ ACA+    Q 
Sbjct: 52  SEEEPILWWSPSPRTIIYIDQLHVSRSLRKAIKKSTFSISFDQAFTEVMIACAEPRAAQD 111

Query: 63  RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
              TWI+  I +AY +L  +G AH+IE W+ D LVGGLYG++LG +FFGESMFS   N+S
Sbjct: 112 DGETWISDGIIEAYSELHRLGQAHSIEVWEGDELVGGLYGIALGRLFFGESMFSRRTNSS 171

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           KI L HLV+ LK+ Q++ +D Q   +HL   GA+EI       L++  ++
Sbjct: 172 KIALFHLVEQLKQWQYVAIDCQVYNDHLASMGAVEIPRKSLEALIQQYVQ 221


>gi|226944898|ref|YP_002799971.1| leucyl/phenylalanyl-tRNA--protein transferase [Azotobacter
           vinelandii DJ]
 gi|259494482|sp|C1DKZ4|LFTR_AZOVD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226719825|gb|ACO78996.1| leucyl/phenylalanyl-tRNA--protein transferase [Azotobacter
           vinelandii DJ]
          Length = 226

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 100/171 (58%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R ++     H  + L+K +R+E + +  +  F +VI ACA        T
Sbjct: 52  GQPILWWSPDPRTVLFPRELHVSRSLRKVLRQERFQVSFDRDFAAVIQACAGPRDYADGT 111

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   ++KAY +L + G AH++E W+  VLVGGLYG+++G +FFGESMFSH +NASK+  
Sbjct: 112 WITPEMRKAYQELHHRGIAHSVEVWQNGVLVGGLYGLAIGQLFFGESMFSHADNASKVGF 171

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             LV+ L++  F+L+D Q  T HL+  GA  I   +++  L + L  P  +
Sbjct: 172 ATLVERLERWGFVLIDCQMPTQHLQSLGARSIPRTEFSDYLMHHLDLPSTA 222


>gi|320354676|ref|YP_004196015.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfobulbus
           propionicus DSM 2032]
 gi|320123178|gb|ADW18724.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfobulbus
           propionicus DSM 2032]
          Length = 227

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 95/166 (57%), Gaps = 1/166 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E FH PKRLK+ +    + +  +TAF  VI+ CA    +R 
Sbjct: 48  SEGDPILWWSPAPRLVLFPEEFHLPKRLKRTLNAGAFTVTADTAFSQVIAGCATAAGRRE 107

Query: 65  T-TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q+AY  L  +G+AH+IE W+   L GGLYGV L  +FFGESMF+ M +ASK
Sbjct: 108 NGTWITGAMQQAYCRLHALGFAHSIECWRDGQLAGGLYGVCLDRIFFGESMFTRMTDASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           + L  LV+    R   ++D Q  T+HL +FGA EI+   +   L+ 
Sbjct: 168 VALAALVEQALHRDIAMIDCQMTTDHLLRFGAREISREAFQARLDQ 213


>gi|217973059|ref|YP_002357810.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella baltica
           OS223]
 gi|254809174|sp|B8E954|LFTR_SHEB2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|217498194|gb|ACK46387.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella baltica
           OS223]
          Length = 237

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 98/170 (57%), Gaps = 1/170 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           NS D I W  P  R +      H    L+KY++++ + I IN AF  V++ CAQ  +K+ 
Sbjct: 52  NSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQS 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L Y G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITQEIQMAYRELHYTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +  L +HL K  F L+D Q + +HL   GA  I  + +  LL     +P
Sbjct: 172 AVAALQQHLLKMGFKLIDAQVMNSHLESLGAKAIKRIDFITLLSELRNNP 221


>gi|296282310|ref|ZP_06860308.1| leucyl/phenylalanyl-tRNA--protein transferase [Citromicrobium
           bathyomarinum JL354]
          Length = 228

 Score =  137 bits (346), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 97/170 (57%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+S   QDI W++P  R IIP+  FH  + L + IRR+++ I +++ F   I  CA   
Sbjct: 21  MAESRRDQDIFWVEPRERAIIPIGGFHCSRSLARTIRRDVFTITVDSDFAGTIVECAAPR 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
                TWI+  I  +Y  L  +G+AH+IE  +   LVGG+YGV+   VF GESMFS   +
Sbjct: 81  ADAEDTWISGRIAASYQRLHEVGHAHSIECRQNGELVGGVYGVAFDRVFCGESMFSRRTD 140

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ASK+ L  L+  L++    L D QF+T HL   GAI I   +Y + L  A
Sbjct: 141 ASKVALGWLLALLERAGCELFDCQFMTGHLASLGAIPIPQSEYLERLHAA 190


>gi|197121254|ref|YP_002133205.1| leucyl/phenylalanyl-tRNA--protein transferase [Anaeromyxobacter sp.
           K]
 gi|220915958|ref|YP_002491262.1| leucyl/phenylalanyl-tRNA/protein transferase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|226736109|sp|B4UEC9|LFTR_ANASK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|254809113|sp|B8JDV1|LFTR_ANAD2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|196171103|gb|ACG72076.1| leucyl/phenylalanyl-tRNA/protein transferase [Anaeromyxobacter sp.
           K]
 gi|219953812|gb|ACL64196.1| leucyl/phenylalanyl-tRNA/protein transferase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 233

 Score =  137 bits (346), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 96/170 (56%), Gaps = 5/170 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---T 66
           I W  P  R ++     H P+ L++ +RR  Y +  + AFE VI  CA++   RP    T
Sbjct: 53  ILWWSPDPRLVLDPAALHVPRSLQRTLRRGAYRVSADEAFERVIRRCAER--DRPGQQGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +  AY+ L  +G AH+ EAW+ D L GGLYGVSLGA FFGESMF+   +ASK+  
Sbjct: 111 WITGEMVDAYVRLHRLGVAHSFEAWEGDALAGGLYGVSLGAAFFGESMFADAPDASKVAF 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
              V+ L+     L+D Q  T HL +FGA EI   ++   L  AL+ P +
Sbjct: 171 VRSVEWLRSAGVELVDCQVRTEHLVRFGAREIPRAEFLARLARALEQPTL 220


>gi|297625312|ref|YP_003687075.1| Leucyl/phenylalanyl-tRNA-protein transferase [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296921077|emb|CBL55618.1| Leucyl/phenylalanyl-tRNA-protein transferase [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 241

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 102/175 (58%), Gaps = 10/175 (5%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           + W  P++RGIIPL +      L++ +RR  Y   I+T+F+ V++ CA  T  RP +WI+
Sbjct: 50  MGWWSPMQRGIIPLPSLRVSHSLRQALRR--YRTTIDTSFDEVLAGCADPT--RPGSWID 105

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMF---SHMENASKIC 125
             ++  Y  LF  G  H++E W  D  LVGGLYGV L  +F GESMF    H  +ASK+ 
Sbjct: 106 DDVKAIYTGLFERGVVHSVETWDDDDRLVGGLYGVGLRGLFAGESMFHDREHGRDASKVA 165

Query: 126 LTHLVKHLKKRQF--LLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           L  LV  L  R     LLD Q++T HL   G +EI   +Y +LL++AL  PE ++
Sbjct: 166 LVRLVDTLSARPDGKALLDTQWLTPHLASLGGVEIPRHRYLELLDDALDAPETAW 220


>gi|167034606|ref|YP_001669837.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas putida
           GB-1]
 gi|189046557|sp|B0KLX3|LFTR_PSEPG RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166861094|gb|ABY99501.1| Leucyltransferase [Pseudomonas putida GB-1]
          Length = 226

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R+  Y +  +T F +VI+ACA        
Sbjct: 51  DGQPILWWSPDPRTVLLPDQLHVSRSLAKLMRQGRYQVSFDTDFPAVIAACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  T++ AY +L   G AH++E  +   LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITDTMRNAYCELHRRGIAHSVEVRQDGKLVGGLYGLAMGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
              LV HL+   F L+D Q  TNHL   GA  I+  ++A  L + L  P 
Sbjct: 171 FVTLVNHLRDAGFALIDCQMPTNHLHSLGAHAISRAEFADYLAHHLDQPN 220


>gi|86157219|ref|YP_464004.1| leucyl/phenylalanyl-tRNA--protein transferase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|119367687|sp|Q2IP38|LFTR_ANADE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|85773730|gb|ABC80567.1| leucyl/phenylalanyl-tRNA--protein transferase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 233

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 96/170 (56%), Gaps = 5/170 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---T 66
           I W  P  R ++     H P+ L++ +RR  Y +  + AFE VI  CA++   RP    T
Sbjct: 53  ILWWSPDPRLLLDPAALHVPRSLQRTLRRGTYRVSADQAFERVIRRCAER--DRPGQQGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   + +AY+ L  +G AH+ EAW  D L GGLYGVSLGA FFGESMF+   +ASK+  
Sbjct: 111 WITAEMVEAYVRLHRLGLAHSFEAWDGDALAGGLYGVSLGAAFFGESMFADAPDASKVAF 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
              V+ L+     L+D Q  T HL +FGA E+   ++   L  AL+ P +
Sbjct: 171 VRSVEWLRSAGVELVDCQVRTEHLVRFGAREVPRAEFLARLARALEQPTL 220


>gi|229591237|ref|YP_002873356.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           fluorescens SBW25]
 gi|259494909|sp|C3JY59|LFTR_PSEFS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|229363103|emb|CAY50108.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudomonas
           fluorescens SBW25]
          Length = 226

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 93/173 (53%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R +I  +  H  + L K +R++ Y +  +  F +VI ACA       
Sbjct: 50  SQGQPILWWSPDPRTVIFPDELHISRSLGKLLRQQRYTVTFDQDFAAVIQACAAPRAYAD 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI  +IQ AY+ L   GYAH++E W    LVGGLYG+++G +FFGESMFS  +NASK 
Sbjct: 110 GTWITQSIQNAYLALHQRGYAHSVEVWDNGELVGGLYGLAMGQLFFGESMFSRADNASKF 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
               L + L+   F+L+D Q   +HL   GA  I+   +A  L + L  P   
Sbjct: 170 GFATLTRQLQAWGFVLIDCQMPNDHLHSLGARAISRSDFAGFLRDHLDQPNTG 222


>gi|237800563|ref|ZP_04589024.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331023423|gb|EGI03480.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 229

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 95/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R+  Y +  +  F SVI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLAKVMRQSRYSVTFDNDFASVIKACAAPRSYANE 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q+AY++L   GYAH++E   +  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITGPMQEAYLELHRRGYAHSVEVRDQGELVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+HL    F+L+D Q  T HL+  GA  I   ++A  L   L  P
Sbjct: 171 FATLVEHLTDWGFVLIDCQMPTQHLQSLGARSIPRREFADYLAQHLDQP 219


>gi|283781016|ref|YP_003371771.1| leucyl/phenylalanyl-tRNA/protein transferase [Pirellula staleyi DSM
           6068]
 gi|283439469|gb|ADB17911.1| leucyl/phenylalanyl-tRNA/protein transferase [Pirellula staleyi DSM
           6068]
          Length = 234

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 93/161 (57%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           SW  P  R IIPL       RL + +R+  Y + I+ AF  VI+ CA   +K    W+  
Sbjct: 55  SWYSPDPRAIIPLGQLRKSSRLCRKLRQREYHVSIDQAFADVIAGCAGPRRKETGVWLTP 114

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLV 130
            +Q+AY+ +   G+AH+IE W    L+GG YGV++G +F  ESMFS + + SKI L  L 
Sbjct: 115 RMQRAYLAMHGAGHAHSIEVWLDGQLIGGTYGVAIGGLFAAESMFSRVSDGSKIALMFLE 174

Query: 131 KHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           + L +R F LLD+Q+I +H R  GA EI   +Y + L  AL
Sbjct: 175 QTLLERGFQLLDVQWINDHTRSLGATEIPRAEYLQRLRAAL 215


>gi|51245755|ref|YP_065639.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfotalea
           psychrophila LSv54]
 gi|50876792|emb|CAG36632.1| related to leucyl/phenylalanyl-tRNA-protein transferase
           [Desulfotalea psychrophila LSv54]
          Length = 233

 Score =  137 bits (344), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISAC-AQKTQKR 63
           +    I W     R +I  + F   KRL +Y ++  Y   I+ AF  VI  C + +T + 
Sbjct: 55  SEGDPILWWYTHPRFVIYPDRFTAGKRLMRYWKKTSYTFTIDQAFSQVIGLCGSSRTGRG 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +++AY  L  +GYAH++E W  D LVGGLYGV LG VFFGESMFS + N+SK
Sbjct: 115 EETWILPEMREAYGQLHELGYAHSVECWDVDRLVGGLYGVELGGVFFGESMFSTVSNSSK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            CL +LV+  +KR   L+D Q  T HL QFGA+EI+  ++ + L+
Sbjct: 175 FCLIYLVEQARKRGVQLIDCQMTTRHLLQFGAVEISGEKFYQHLQ 219


>gi|118572933|sp|Q6ALZ3|LFTR_DESPS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 227

 Score =  137 bits (344), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISAC-AQKTQKR 63
           +    I W     R +I  + F   KRL +Y ++  Y   I+ AF  VI  C + +T + 
Sbjct: 49  SEGDPILWWYTHPRFVIYPDRFTAGKRLMRYWKKTSYTFTIDQAFSQVIGLCGSSRTGRG 108

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +++AY  L  +GYAH++E W  D LVGGLYGV LG VFFGESMFS + N+SK
Sbjct: 109 EETWILPEMREAYGQLHELGYAHSVECWDVDRLVGGLYGVELGGVFFGESMFSTVSNSSK 168

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            CL +LV+  +KR   L+D Q  T HL QFGA+EI+  ++ + L+
Sbjct: 169 FCLIYLVEQARKRGVQLIDCQMTTRHLLQFGAVEISGEKFYQHLQ 213


>gi|304409059|ref|ZP_07390680.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella baltica
           OS183]
 gi|307303062|ref|ZP_07582817.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella baltica
           BA175]
 gi|304352880|gb|EFM17277.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella baltica
           OS183]
 gi|306913422|gb|EFN43844.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella baltica
           BA175]
          Length = 237

 Score =  137 bits (344), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 97/170 (57%), Gaps = 1/170 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           NS D I W  P  R +      H    L+KY++++ + I IN AF  V++ CAQ  +K+ 
Sbjct: 52  NSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQS 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L Y G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITQEIQMAYRELHYTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +  L +HL K  F L+D Q +  HL   GA  I  + +  LL     +P
Sbjct: 172 AVAALQQHLLKMGFKLIDAQVMNPHLESLGAKAIKRIDFITLLSELRNNP 221


>gi|218891222|ref|YP_002440088.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           aeruginosa LESB58]
 gi|296388924|ref|ZP_06878399.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           aeruginosa PAb1]
 gi|226737709|sp|B7UV24|LFTR_PSEA8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|218771447|emb|CAW27214.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa LESB58]
          Length = 226

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 98/174 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
              LV+HL+   F+L+D Q  T HL   GA  I+  ++A  L+     P    L
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDL 224


>gi|15597813|ref|NP_251307.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           aeruginosa PAO1]
 gi|254235603|ref|ZP_04928926.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa C3719]
 gi|33301326|sp|Q9I0M1|LFTR_PSEAE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|9948683|gb|AAG06005.1|AE004690_5 leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa PAO1]
 gi|126167534|gb|EAZ53045.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa C3719]
          Length = 226

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 98/174 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRNYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
              LV+HL+   F+L+D Q  T HL   GA  I+  ++A  L+     P    L
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDL 224


>gi|49081902|gb|AAT50351.1| PA2617 [synthetic construct]
          Length = 227

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 98/174 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRNYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
              LV+HL+   F+L+D Q  T HL   GA  I+  ++A  L+     P    L
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDL 224


>gi|224825735|ref|ZP_03698839.1| leucyl/phenylalanyl-tRNA/protein transferase [Lutiella nitroferrum
           2002]
 gi|224601959|gb|EEG08138.1| leucyl/phenylalanyl-tRNA/protein transferase [Lutiella nitroferrum
           2002]
          Length = 233

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 96/173 (55%), Gaps = 2/173 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++        + L K +R   Y+IR++TAF  V+ ACA     +P
Sbjct: 49  SPGEPILWWSPSERMVLFPSELRITRSLAKTLRNHPYEIRVDTAFREVMKACAAPRDGQP 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +G AH+ E W++ VLVGGLYGV+LG +F+GESMFS + NASK+
Sbjct: 109 GTWIGPGMVDAYCHLHELGLAHSFETWQQGVLVGGLYGVALGRMFYGESMFSRVSNASKL 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN--ALKHPE 175
              H+ +HL+   F ++D Q  T HL   GA  I   ++   L+    L  PE
Sbjct: 169 AFVHMSRHLQNCGFAMIDCQMYTPHLASLGARRIPRHEFLATLKELVGLSAPE 221


>gi|107102139|ref|ZP_01366057.1| hypothetical protein PaerPA_01003189 [Pseudomonas aeruginosa PACS2]
 gi|116050604|ref|YP_790577.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|122259727|sp|Q02NA9|LFTR_PSEAB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|115585825|gb|ABJ11840.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 226

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 98/174 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNHDFRAVIQACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
              LV+HL+   F+L+D Q  T HL   GA  I+  ++A  L+     P    L
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDL 224


>gi|90021336|ref|YP_527163.1| leucyl/phenylalanyl-tRNA--protein transferase [Saccharophagus
           degradans 2-40]
 gi|119367723|sp|Q21K28|LFTR_SACD2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|89950936|gb|ABD80951.1| Leucyltransferase [Saccharophagus degradans 2-40]
          Length = 243

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 93/158 (58%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           +SQ I W  P  R ++  +  H  K LKK  +++ + I I+T F  V+  CAQ    +  
Sbjct: 53  DSQPILWWSPDPRMVLLPQNLHLGKTLKKLAKKQAFKITIDTHFSDVMQGCAQPRADQDG 112

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   ++ AY++L  +GYAH+IEAW+   LVGGLYG+++  VF+GESMFS +  ASKI 
Sbjct: 113 TWITTDMENAYLELHKLGYAHSIEAWQDGELVGGLYGIAINRVFYGESMFSKVSGASKIA 172

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
             +L   L    F  +D Q  T +L  FGA E+  V++
Sbjct: 173 FANLATQLASWGFYAIDCQVATEYLASFGAAEMPRVEF 210


>gi|152986914|ref|YP_001347954.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           aeruginosa PA7]
 gi|166224667|sp|A6V4G9|LFTR_PSEA7 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|150962072|gb|ABR84097.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           aeruginosa PA7]
          Length = 226

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 94/163 (57%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLLPEELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W+   LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGVAHSVEVWQAGQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
              LV+HL+   F+L+D Q  T HL   GA  I+   +A  L+
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISREAFADYLQ 213


>gi|313107654|ref|ZP_07793837.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa 39016]
 gi|310880339|gb|EFQ38933.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa 39016]
          Length = 226

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 97/174 (55%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
              LV+HL+   F+L+D Q  T HL   GA  I   ++A  L+     P    L
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAIGRGEFADYLQRYRDQPPTGDL 224


>gi|303242600|ref|ZP_07329076.1| leucyl/phenylalanyl-tRNA/protein transferase [Acetivibrio
           cellulolyticus CD2]
 gi|302589857|gb|EFL59629.1| leucyl/phenylalanyl-tRNA/protein transferase [Acetivibrio
           cellulolyticus CD2]
          Length = 227

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 96/167 (57%), Gaps = 2/167 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R I+  +     K ++K +R+ +Y +  +T F +VI+ C +   +   T
Sbjct: 50  DQPILWWSPNPRFILYPKNLKVSKSMEKVLRKTIYKVTFDTCFRNVITMCGK--LRSGNT 107

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   + ++Y DL  +G+AH+IEAW  D LVGGLYGVSLG  FFGESMFS M+NASK  L
Sbjct: 108 WITEDMIESYCDLHQLGFAHSIEAWFGDELVGGLYGVSLGKCFFGESMFSTMDNASKTAL 167

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             L + L +  F  +D Q  T HL   GA+ ++   + + LE  L H
Sbjct: 168 ITLTRELSQLGFHFIDCQVYTKHLESLGAVSVSRDTFLQELEEGLTH 214


>gi|119898499|ref|YP_933712.1| leucyl/phenylalanyl-tRNA--protein transferase [Azoarcus sp. BH72]
 gi|158512912|sp|A1K7M0|LFTR_AZOSB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119670912|emb|CAL94825.1| probable leucyl/phenylalanyl-tRNA--protein transferase [Azoarcus
           sp. BH72]
          Length = 235

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 96/165 (58%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + I W  P  R ++        + L+K +R   +++R +TAF  VI  CA   +   
Sbjct: 49  SDGEPILWWSPDPRLVLQPAQIRITRSLRKVLRGRRFEVRFDTAFARVIEECAAPREPGG 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I+ AY+ +  +GYAH++E+W    LVGGLYG++LG  FFGESMFS + +ASK+
Sbjct: 109 GTWITPEIRAAYLRMHELGYAHSVESWLDGRLVGGLYGMALGRAFFGESMFSRVSDASKV 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            L HL + L++R F ++D Q  T HL   GA EI   ++   LE 
Sbjct: 169 ALAHLARFLEQRDFGVIDCQMTTPHLLSMGAHEIARREFCAGLER 213


>gi|83816426|ref|YP_444962.1| leucyl/phenylalanyl-tRNA--protein transferase [Salinibacter ruber
           DSM 13855]
 gi|119367724|sp|Q2S4B9|LFTR_SALRD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|83757820|gb|ABC45933.1| leucyl/phenylalanyl-tRNA--protein transferase [Salinibacter ruber
           DSM 13855]
          Length = 226

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 94/163 (57%), Gaps = 4/163 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           + W  P  R  +PL+ FH P  L++ +RR  + +  + AF SVI ACA + +    TWI 
Sbjct: 29  VRWHAPDPRAYLPLDAFHIPHNLRRRVRRREFSVTADRAFASVIEACADRAR----TWIT 84

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I + Y +L   GYAH++E W++  L GGLYGV L   FFGESMF  + NASK+ L HL
Sbjct: 85  PRIIRVYTELHERGYAHSVECWQEGDLAGGLYGVGLKGAFFGESMFYRVSNASKVALVHL 144

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           V+ L+   F LLD Q+ T HL +FG   +    + + L  AL 
Sbjct: 145 VRQLRAGGFTLLDTQYSTEHLERFGVTTVPRPAFEQKLIRALD 187


>gi|114767026|ref|ZP_01445934.1| leucyl/phenylalanyl-tRNA--protein transferase [Pelagibaca
           bermudensis HTCC2601]
 gi|114540810|gb|EAU43874.1| leucyl/phenylalanyl-tRNA--protein transferase [Roseovarius sp.
           HTCC2601]
          Length = 212

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 99/171 (57%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  ++ W+ P RRGI+P++  H  + L + +RR+ Y + ++  FE VI ACA + 
Sbjct: 20  MAEHRDDPELFWVDPRRRGILPMDGLHISRSLARRLRRDDYTVTLDADFEGVIDACADRR 79

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  ++ L   G AH++E W +  L GG+YG+ +G  F GESMFS   +
Sbjct: 80  E----TWINHEIRALFVTLHQRGLAHSLEVWMEGELAGGVYGLEIGGAFCGESMFSRRRD 135

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            SKI L  L+  L++  F L D QF+T HL   G +EIT   Y   L  AL
Sbjct: 136 GSKIALCWLIDLLRRAGFTLFDTQFLTEHLATLGGLEITRANYRAQLREAL 186


>gi|254241050|ref|ZP_04934372.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa 2192]
 gi|126194428|gb|EAZ58491.1| leucyl/phenylalanyl-tRNA-protein transferase [Pseudomonas
           aeruginosa 2192]
          Length = 226

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 97/174 (55%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ +++  N  F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNHDFRAVIQACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY +L   G AH++E W++  LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
              LV+HL+   F+L+D Q  T HL   GA  I   ++A  L+     P    L
Sbjct: 171 FVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAIGRGEFADYLQRYRDQPPTGDL 224


>gi|162454071|ref|YP_001616438.1| leucyl/phenylalanyl-tRNA--protein transferase [Sorangium cellulosum
           'So ce 56']
 gi|161164653|emb|CAN95958.1| leucyl/phenylalanyl-tRNA--protein transferase [Sorangium cellulosum
           'So ce 56']
          Length = 217

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 93/166 (56%), Gaps = 5/166 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---TWI 68
           W  P  R ++P    H P  L+K +RR   ++R +TAFE V+ AC+     RP    TWI
Sbjct: 32  WFSPDPRFVLPPREAHVPHSLRKRVRRGEIEVRADTAFERVMQACS--AAPRPGQNGTWI 89

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +   Y  L   G AH+IEAW    LVGGLYGVSLG +FFGESMF+   +ASK+    
Sbjct: 90  TEELIAGYTALHAAGVAHSIEAWSNGELVGGLYGVSLGRMFFGESMFARAPDASKVAFAT 149

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           L+ +L    F L+D Q  T HL +FGA+E    ++   L+ AL  P
Sbjct: 150 LLGNLVAWDFALVDCQVYTEHLERFGAVEWPRREFLGALKVALDAP 195


>gi|170722574|ref|YP_001750262.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas putida
           W619]
 gi|226737710|sp|B1JBE5|LFTR_PSEPW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|169760577|gb|ACA73893.1| Leucyltransferase [Pseudomonas putida W619]
          Length = 226

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 95/170 (55%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++     H  + L K +R+  Y +  +T F +VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPNELHVSRSLAKLLRQGRYQVSFDTDFPAVIDACAAPRDYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  T++ AY +L   G AH++E      LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITDTMRNAYCELHRRGIAHSVEVRHNGELVGGLYGLAMGRLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
              LVKHL++  F+L+D Q  T+HL   GA  I+   +A  L + L  P 
Sbjct: 171 FVTLVKHLQEAGFVLIDCQMPTDHLHSLGARAISRASFADYLAHHLDQPN 220


>gi|125973733|ref|YP_001037643.1| leucyl/phenylalanyl-tRNA--protein transferase [Clostridium
           thermocellum ATCC 27405]
 gi|256005535|ref|ZP_05430496.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           thermocellum DSM 2360]
 gi|281417890|ref|ZP_06248910.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           thermocellum JW20]
 gi|158513251|sp|A3DES1|LFTR_CLOTH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|125713958|gb|ABN52450.1| Leucyltransferase [Clostridium thermocellum ATCC 27405]
 gi|255990515|gb|EEU00636.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           thermocellum DSM 2360]
 gi|281409292|gb|EFB39550.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           thermocellum JW20]
 gi|316940073|gb|ADU74107.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           thermocellum DSM 1313]
          Length = 233

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 101/169 (59%), Gaps = 2/169 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++  +     + ++K+++++LY++  +T F  VI+ CA+   +  
Sbjct: 48  SEDEPILWWSPNPRCVLFPKDIKISRSMRKFLKKQLYEVTFDTCFRHVIAMCAK--LREG 105

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I ++Y  L  +G+AH++E W +  LVGGLYGVSLG  FFGESMFS M+NASK 
Sbjct: 106 NTWITPEIIESYSKLHDLGFAHSVETWYEGRLVGGLYGVSLGKCFFGESMFSTMDNASKT 165

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            L  L + L+++ FLL+D Q  + HL   GA+ I    + K LE  L H
Sbjct: 166 ALITLCQKLEEKGFLLIDCQVYSKHLESLGAVNIDRDLFLKYLEAGLSH 214


>gi|308272840|emb|CBX29444.1| Leucyl/phenylalanyl-tRNA--protein transferase [uncultured
           Desulfobacterium sp.]
          Length = 228

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 102/173 (58%), Gaps = 1/173 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           +  + I W  P  R +I  +     K L K I++ ++ I  + AFE VI+ CA  + +K 
Sbjct: 48  SEDEPILWWSPDPRLVIYPDEIRISKSLHKIIKKNVFHITFDMAFEQVINLCAGVRRKKN 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   + +AY  LF  GYAH++EAWK + L GGLYGVSLG  FFGESMFS   NASK
Sbjct: 108 EGTWIVPDMIEAYCMLFKSGYAHSVEAWKDNKLAGGLYGVSLGRCFFGESMFSLEANASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           +    L ++L+ + F  +D Q  T+HL++FGA EI    + K L+ AL  P +
Sbjct: 168 VAFVALSQYLENKAFDFIDCQVATDHLKRFGAKEIHRSLFLKQLKKALVLPTL 220


>gi|294506821|ref|YP_003570879.1| Leucyl/phenylalanyl-tRNA--protein transferase [Salinibacter ruber
           M8]
 gi|294343149|emb|CBH23927.1| Leucyl/phenylalanyl-tRNA--protein transferase [Salinibacter ruber
           M8]
          Length = 245

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 94/163 (57%), Gaps = 4/163 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           + W  P  R  +PL+ FH P  L++ +RR  + +  + AF SVI ACA + +    TWI 
Sbjct: 48  VRWHAPDPRAHLPLDAFHIPHNLRRRVRRREFSVTADRAFASVIEACADRAR----TWIT 103

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I + Y +L   GYAH++E W++  L GGLYGV L   FFGESMF  + NASK+ L HL
Sbjct: 104 PRIIRVYTELHERGYAHSVECWQEGDLAGGLYGVGLKGAFFGESMFYRVSNASKVALVHL 163

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           V+ L+   F LLD Q+ T HL +FG   +    + + L  AL 
Sbjct: 164 VRQLRAGGFTLLDTQYSTEHLERFGVTTVPRPAFEQKLIRALD 206


>gi|160875694|ref|YP_001555010.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella baltica
           OS195]
 gi|189046560|sp|A9L4G0|LFTR_SHEB9 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|160861216|gb|ABX49750.1| Leucyltransferase [Shewanella baltica OS195]
 gi|315267883|gb|ADT94736.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella baltica
           OS678]
          Length = 237

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 97/170 (57%), Gaps = 1/170 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           NS D I W  P  R +      H    L+KY++++ + I IN AF  V++ CAQ  +K+ 
Sbjct: 52  NSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQS 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITQEIQMAYRELHHTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +  L +HL K  F L+D Q +  HL   GA  I  + +  LL     +P
Sbjct: 172 AVAALQQHLLKMGFKLIDAQVMNPHLESLGAKAIKRIDFITLLSELRNNP 221


>gi|126174682|ref|YP_001050831.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella baltica
           OS155]
 gi|166224671|sp|A3D5E9|LFTR_SHEB5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|125997887|gb|ABN61962.1| Leucyltransferase [Shewanella baltica OS155]
          Length = 237

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 97/170 (57%), Gaps = 1/170 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           NS D I W  P  R +      H    L+KY++++ + I IN AF  V++ CAQ  +K+ 
Sbjct: 52  NSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQS 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITQEIQMAYRELHHTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +  L +HL K  F L+D Q +  HL   GA  I  + +  LL     +P
Sbjct: 172 AVAALQQHLLKMGFKLIDAQVMNPHLESLGAKAIKRIDFITLLSELRNNP 221


>gi|126732549|ref|ZP_01748347.1| leucyl/phenylalanyl-tRNA--protein transferase [Sagittula stellata
           E-37]
 gi|126706995|gb|EBA06063.1| leucyl/phenylalanyl-tRNA--protein transferase [Sagittula stellata
           E-37]
          Length = 217

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (60%), Gaps = 4/171 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +  +I W+ P RRG++P++ FH  + L K ++R+ Y + +NT F  VI  CA + 
Sbjct: 19  MAERHDDPEIFWVDPRRRGVLPIKQFHISRSLAKRLKRDDYSVTLNTDFGGVIDGCADRA 78

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  I+  Y  LF MG+AH++E W  + LVGG+YGVS+G  F GESMFS + +
Sbjct: 79  E----TWINDEIRLLYEALFDMGHAHSLEVWADEALVGGVYGVSVGGAFCGESMFSRITD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           ASKI L  L   L +  + L D QF+T HL   GA EIT   Y  LL  AL
Sbjct: 135 ASKIALAWLTDLLGRTGYTLFDTQFLTPHLATLGASEITRSDYRHLLARAL 185


>gi|153000981|ref|YP_001366662.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella baltica
           OS185]
 gi|166224672|sp|A6WP60|LFTR_SHEB8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|151365599|gb|ABS08599.1| Leucyltransferase [Shewanella baltica OS185]
          Length = 237

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 97/170 (57%), Gaps = 1/170 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           NS D I W  P  R +      H    L+KY++++ + I IN AF  V++ CAQ  +K+ 
Sbjct: 52  NSDDPILWWSPDPRAVFIPGEVHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQS 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITQEIQMAYRELHHTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +  L +HL K  F L+D Q +  HL   GA  I  + +  LL     +P
Sbjct: 172 AVAALQQHLLKMGFKLIDAQVMNPHLESLGAKGIKRIDFITLLRELRNNP 221


>gi|329905486|ref|ZP_08274143.1| Leucyl/phenylalanyl-tRNA-protein transferase [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327547589|gb|EGF32389.1| Leucyl/phenylalanyl-tRNA-protein transferase [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 251

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 89/147 (60%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIE 89
           K L+K  R   +++R ++AFE V+ ACA   +  P TWI+  I   Y  L  +GYAH+ E
Sbjct: 82  KTLRKVARDSRWEVRFDSAFEDVMRACAAPRRDGPGTWISDDIVAGYCGLHRLGYAHSSE 141

Query: 90  AWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNH 149
            W+   LVGG YGVS+G +F+GESMF+ + +ASKI L HLV  LK +   ++D Q  T H
Sbjct: 142 VWRDGELVGGAYGVSIGRMFYGESMFARVTDASKIALAHLVGFLKSQSVSMIDCQQETAH 201

Query: 150 LRQFGAIEITHVQYAKLLENALKHPEI 176
           L   GA  I+   + + L +A+  P+I
Sbjct: 202 LASLGATPISRAAFLRHLRDAIAQPQI 228


>gi|113476796|ref|YP_722857.1| leucyl/phenylalanyl-tRNA--protein transferase [Trichodesmium
           erythraeum IMS101]
 gi|110167844|gb|ABG52384.1| Leucyltransferase [Trichodesmium erythraeum IMS101]
          Length = 193

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 104/172 (60%), Gaps = 7/172 (4%)

Query: 5   ANSQD--ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ 61
           AN ++  + W    +R +IPL E F  P+ L++ I +  + + +N  FE+V+  CA    
Sbjct: 21  ANDEEDSLGWYSSYQRTLIPLDERFRYPRSLRRAINQNRFTVAVNRDFEAVVKGCA---- 76

Query: 62  KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            R TTWI+  +++ Y +L  +GYA++ E W+ D L GG+ G+ +G+ F GESMF ++   
Sbjct: 77  ARETTWISEELKQIYKNLNKVGYAYSFETWQGDELAGGILGIVIGSAFIGESMFYNIPEG 136

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           SK+ +  LV+ L+KR+F+L D Q    HL +FGA  I+  +Y  LL+ AL H
Sbjct: 137 SKVAMVKLVERLRKRKFVLFDAQMNNPHLERFGAYSISDKKYKALLKYALSH 188


>gi|162149201|ref|YP_001603662.1| putative leucyl/phenylalanyl-tRNA--protein transferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787778|emb|CAP57374.1| putative leucyl/phenylalanyl-tRNA--protein transferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 250

 Score =  134 bits (336), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 80/123 (65%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA  A S  + W  P  RGI+PL+ FH P+RL + +  + +DI  +  FE+ I ACA   
Sbjct: 35  MAPDAESAHLDWYDPDMRGILPLDAFHVPRRLLRTVLSDRFDIVADRHFEATIRACAAPA 94

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R TTWIN  I + + DL  MGYAH++E+W+  VLVGGLYGV++G  FFGESMFS   +
Sbjct: 95  PGRETTWINERIVRLFCDLHDMGYAHSVESWQDGVLVGGLYGVAIGGAFFGESMFSRRTD 154

Query: 121 ASK 123
           ASK
Sbjct: 155 ASK 157


>gi|114330663|ref|YP_746885.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosomonas
           eutropha C91]
 gi|122314357|sp|Q0AIB2|LFTR_NITEC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|114307677|gb|ABI58920.1| Leucyltransferase [Nitrosomonas eutropha C91]
          Length = 234

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  +     + L K +++  Y IR ++AF  V+ ACA   +K+  TWI+
Sbjct: 54  ILWWSPNPRMVLFPQELKISRSLHKTLKKNHYQIRTDSAFTQVMQACAAPREKQTGTWIH 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L   G AH++E W    LVGGLYGV++G  FFGESMFS + +ASKI L +L
Sbjct: 114 PEMVAAYTTLHQRGIAHSVETWVDGELVGGLYGVAIGKAFFGESMFSRVPDASKIALVYL 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
            + L+++ + L+D Q  T HL   GA EI  +Q++KLL      PE
Sbjct: 174 ARQLERQGYGLIDCQMKTAHLMSMGAREIPRLQFSKLLGKLTDQPE 219


>gi|119384015|ref|YP_915071.1| leucyl/phenylalanyl-tRNA--protein transferase [Paracoccus
           denitrificans PD1222]
 gi|158512589|sp|A1B1I1|LFTR_PARDP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119373782|gb|ABL69375.1| Leucyltransferase [Paracoccus denitrificans PD1222]
          Length = 212

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 99/174 (56%), Gaps = 4/174 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA++  + W +P  RGI+P+   H  + +++++R   +   I+  F  V++ CA + 
Sbjct: 21  MAESASAAQLYWFEPALRGILPVGGVHVSRSMRRFLRHCDWRATIDNDFAGVVAGCADRE 80

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
           +    TWIN  +   Y DLF MG+AH++E    + L+GG++G++LG  FF ESMFS   N
Sbjct: 81  E----TWINAPLLALYQDLFRMGHAHSLEIRAGEDLIGGMFGLTLGGAFFAESMFSRRSN 136

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK  L  +  HL +  F L D Q+   HL   G   I  ++Y + L  AL+ P
Sbjct: 137 ASKAALIWMSSHLARCGFTLWDTQYPNPHLASMGGRAIPRLEYRRRLAAALRIP 190


>gi|323697698|ref|ZP_08109610.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio sp.
           ND132]
 gi|323457630|gb|EGB13495.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           desulfuricans ND132]
          Length = 230

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 104/172 (60%), Gaps = 2/172 (1%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-K 62
           + NS  + W    R  + P E  H P+ L++ + R  +   ++T FE+VI  CA   + +
Sbjct: 48  AENSPILWWSTNPRLALRP-EELHVPRSLRRVLNRGTFTFTLDTRFEAVIRRCACSPRPE 106

Query: 63  RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
           +  TWI   + +AYI L  +GYAH++EAW+ D LVGGLYGVSLG++F+GESMF ++ +AS
Sbjct: 107 QEGTWIVDEMIEAYILLHRLGYAHSVEAWQGDDLVGGLYGVSLGSIFYGESMFHNVPDAS 166

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           K      V+ L+K  F L+D Q  T+HL +FGA E+   ++  +L   L  P
Sbjct: 167 KAAFAVFVEQLRKWGFTLIDCQQTTHHLLRFGARELQRFRFMAMLREGLNAP 218


>gi|146282643|ref|YP_001172796.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas stutzeri
           A1501]
 gi|158514178|sp|A4VLV3|LFTR_PSEU5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|145570848|gb|ABP79954.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas stutzeri
           A1501]
          Length = 226

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 93/172 (54%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q + W  P  R ++  +  H  + L+K +R   Y +  + AF  VI  CA        
Sbjct: 51  EGQPLLWWSPDPRTVLFPDELHVSRSLRKRMRHGDYRVTFDKAFAEVIQGCAGPRSYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY+ L  MG AH++E W++  LVGGLYG+++G +FFGESMFS   +ASK+ 
Sbjct: 111 TWITTPMQDAYVRLHEMGVAHSVEVWQQGQLVGGLYGLAMGELFFGESMFSRATDASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
              LV+ L++  F L+D Q  T HL  FGA  I    +A+ L   L  P  +
Sbjct: 171 FVTLVERLREWGFALIDCQMPTRHLESFGARSIPRAAFAEALAMHLDRPSAA 222


>gi|304311210|ref|YP_003810808.1| Leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium HdN1]
 gi|301796943|emb|CBL45156.1| Leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium HdN1]
          Length = 253

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 91/164 (55%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q I W  P  R ++  E     + L+K +R+  + I  +TAF  VI ACA        TW
Sbjct: 55  QPILWWSPSVRALLLPENLRISRSLRKTLRKNHFTITADTAFSEVIRACAAPRSYADGTW 114

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I   +QKAY  L   G+AH++E W +  LVGGLYGV++G  +FGESMFS   ++SK+   
Sbjct: 115 ITPEMQKAYTALHQAGHAHSLEVWAQGELVGGLYGVTVGGCYFGESMFSRETDSSKVAFV 174

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            LV++L  R F L+D Q +T HL   GA  I    Y K L+  L
Sbjct: 175 ALVRYLSLRNFALIDCQMMTPHLESLGATPIARSVYLKKLQKIL 218


>gi|289208232|ref|YP_003460298.1| leucyl/phenylalanyl-tRNA/protein transferase [Thioalkalivibrio sp.
           K90mix]
 gi|288943863|gb|ADC71562.1| leucyl/phenylalanyl-tRNA/protein transferase [Thioalkalivibrio sp.
           K90mix]
          Length = 255

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 91/157 (57%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R ++    F   + LKK IR   Y +  + AFE+VI ACA   +    T
Sbjct: 61  GQPILWWSPDPRAVLEPGHFRMHRSLKKAIRNRGYTVSFDRAFEAVIEACAGPREYAEGT 120

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI  ++Q+AYI +   G+AH++E W    L+GGLYGV++G +F GESMFS   +ASKI L
Sbjct: 121 WITASMQQAYIAMHRTGHAHSVEVWDGPRLIGGLYGVAVGRLFCGESMFSRERDASKIAL 180

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
             L +HL    + L+D+Q  T HLR  GAI +   ++
Sbjct: 181 AWLCRHLVAWDWPLVDVQMETEHLRNLGAITLPRREF 217


>gi|327480901|gb|AEA84211.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas stutzeri
           DSM 4166]
          Length = 226

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 92/172 (53%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q + W  P  R ++  +  H  + L+K +R   Y +  + AF  VI  CA        
Sbjct: 51  EGQPLLWWSPDPRTVLFPDELHVSRSLRKRMRHGDYRVTFDKAFAEVIQGCAGPRSYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY  L  MG AH++E W++  LVGGLYG+++G +FFGESMFS   +ASK+ 
Sbjct: 111 TWITTPMQDAYARLHEMGVAHSVEVWQQGQLVGGLYGIAMGELFFGESMFSRATDASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
              LV+ L++  F L+D Q  T HL  FGA  I    +A+ L   L  P  +
Sbjct: 171 FVTLVERLREWGFALIDCQMPTRHLESFGARSIPRAAFAEALAMHLDRPSAA 222


>gi|91775285|ref|YP_545041.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylobacillus
           flagellatus KT]
 gi|91775429|ref|YP_545185.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylobacillus
           flagellatus KT]
 gi|91709272|gb|ABE49200.1| Leucyltransferase [Methylobacillus flagellatus KT]
 gi|91709416|gb|ABE49344.1| Leucyltransferase [Methylobacillus flagellatus KT]
          Length = 244

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 99/171 (57%), Gaps = 1/171 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  + I W  P  R ++        + L K ++R  Y+IR NTAF  VI+ACA   ++ +
Sbjct: 73  SEGEPILWWSPDPRMVLFPGELKISRSLAKRLKRRDYEIRFNTAFSQVIAACAATPREGQ 132

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   I +AY  L  +G+AH+ E W    LVGGLYGVSLG +F+GESMF H  +ASK
Sbjct: 133 DGTWITDGIMEAYNTLHLLGHAHSAETWVDGKLVGGLYGVSLGRMFYGESMFHHTTDASK 192

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           +   H+V+ L+   + ++D Q  T HL   GA EIT  ++++ L   + +P
Sbjct: 193 LAFVHMVRRLQALGYGMIDCQMKTRHLASLGAREITRAEFSQRLNELVHYP 243


>gi|114320866|ref|YP_742549.1| leucyl/phenylalanyl-tRNA--protein transferase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311513|sp|Q0A7X8|LFTR_ALHEH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|114227260|gb|ABI57059.1| Leucyltransferase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 258

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 94/171 (54%), Gaps = 1/171 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
              Q I W  P  R I      H  +RL + +R   + + ++T F  VISACA   + + 
Sbjct: 54  GPGQPILWWSPDPRCIFRPGWLHVSRRLARRLRTGAFRMSLDTDFTGVISACAAPREDQA 113

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASK 123
            TWI   +  AY  LF +G AH++E W +D  LVGGLYGV+L   FFGESMFS   +ASK
Sbjct: 114 GTWIVPEMMHAYEALFELGIAHSVECWDRDGELVGGLYGVALSGAFFGESMFSRRSDASK 173

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            C+  L   L +  F L D Q  + HLR+ GA++++  ++   L+ AL  P
Sbjct: 174 ACMAWLSAQLHRWGFALFDCQVSSPHLRRMGAVDVSRSRFLAQLQQALVLP 224


>gi|330958177|gb|EGH58437.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 229

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 91/169 (53%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++     H  + L K +R+  Y +  +  F  VI ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPAELHVSRSLAKLLRQARYTVTFDQDFARVIEACAAPRSYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  ++Q AY++L   G+AH++E W +  LVGGLYG+++G +FFGESMFS  +NASK  
Sbjct: 111 TWITDSMQDAYLELHRRGHAHSVEVWDQGELVGGLYGLAMGQLFFGESMFSRADNASKFG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV+ L    F+L+D Q  T HL  FGA  I    +A  L   L  P
Sbjct: 171 FATLVERLTAWGFVLIDCQMPTQHLHSFGARAIPREAFADYLARHLGQP 219


>gi|119775188|ref|YP_927928.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           amazonensis SB2B]
 gi|158513089|sp|A1S7A2|LFTR_SHEAM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119767688|gb|ABM00259.1| Leucyltransferase [Shewanella amazonensis SB2B]
          Length = 236

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 98/170 (57%), Gaps = 1/170 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N++D I W  P  R +         + LKK +++  + + IN AF  V++ CAQ  +K+ 
Sbjct: 52  NAEDPILWWSPDPRAVFLPGELKISRSLKKSLKKHPWRVTINHAFADVMAGCAQPRKKQR 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY+++   G+AH++E W KD LVGGLYG+++G VF GESMF    +ASK+
Sbjct: 112 DTWITQEIQLAYLEMHSQGHAHSVEVWMKDRLVGGLYGLAIGKVFCGESMFHRETDASKL 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +  L +HL +  F LLD Q +  HL   GA E++   +  LL+     P
Sbjct: 172 AMMALHQHLLQHDFKLLDAQIMNPHLESLGAREVSRTAFLSLLKRYRDEP 221


>gi|325980922|ref|YP_004293324.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitrosomonas sp.
           AL212]
 gi|325530441|gb|ADZ25162.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitrosomonas sp.
           AL212]
          Length = 233

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 94/160 (58%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q I W  P  R ++        + L+K +++  Y I  +  F  V+ ACA   + +P TW
Sbjct: 52  QPILWWSPDPRMVLFPHQLKISRSLRKAVKKTHYKICTDCNFTQVMLACAAPREGQPGTW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  +  AY  L  MG AH +E W    L GGLYGV+LG VFFGESMFS +++ASKI L 
Sbjct: 112 IHPQMIAAYTALHEMGLAHCVETWIDGELAGGLYGVALGKVFFGESMFSRVQDASKIALV 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           HLVK L+  QF L+D Q  T+HL   GA EI+  ++++ L
Sbjct: 172 HLVKQLQFWQFGLIDCQVKTHHLASLGAQEISRAEFSQKL 211


>gi|192361182|ref|YP_001983025.1| leucyl/phenylalanyl-tRNA--protein transferase [Cellvibrio japonicus
           Ueda107]
 gi|226736118|sp|B3PL51|LFTR_CELJU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|190687347|gb|ACE85025.1| leucyl/phenylalanyl-tRNA--protein transferase [Cellvibrio japonicus
           Ueda107]
          Length = 235

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 97/165 (58%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++     H  + L+K +R+ +Y +  +  F  V+ ACA        TWI+
Sbjct: 55  ILWWSPHPRTVVFPHQHHVSRSLRKTLRKGIYRVTFDHCFAQVMRACAAPRAYANGTWIS 114

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  +Y  L   GYAH++E W+ + LVGGLYG+SLG +FFGESMFS  +NASK    +L
Sbjct: 115 EQMISSYTRLHEQGYAHSVEVWQDENLVGGLYGLSLGKIFFGESMFSRADNASKTGFAYL 174

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           V+ L++  F L+D Q  ++HL   GA+EI+  ++ K+L +  + P
Sbjct: 175 VRQLQQWDFRLIDCQVASDHLFTLGAVEISRDEFQKMLVHFTEQP 219


>gi|284929022|ref|YP_003421544.1| leucyl/phenylalanyl-tRNA--protein transferase [cyanobacterium
           UCYN-A]
 gi|284809481|gb|ADB95186.1| leucyl/phenylalanyl-tRNA--protein transferase [cyanobacterium
           UCYN-A]
          Length = 194

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 97/165 (58%), Gaps = 5/165 (3%)

Query: 10  ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           ++W    +R +IPL E F  PK L++ + +E + I IN  F  V   CA+    R TTWI
Sbjct: 28  LNWYSSYQRTLIPLDERFRYPKSLQRILNQEQFSISINKKFLEVCQGCAE----RETTWI 83

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              + + Y  L   G+AH+ E W+ D L GG+ G+++G+ F GESMF  + N SK+ +  
Sbjct: 84  TPELIQIYYQLHLNGFAHSFETWQGDQLAGGILGIAIGSAFIGESMFYRIPNGSKVAMVK 143

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           LV+HL+  +F L D+Q   NHL +FG+  I + +Y +LL  AL +
Sbjct: 144 LVEHLRSVKFTLFDVQLQNNHLERFGSYVINNNEYKRLLCEALNN 188


>gi|239994974|ref|ZP_04715498.1| leucyl/phenylalanyl-tRNA-protein transferase [Alteromonas macleodii
           ATCC 27126]
          Length = 248

 Score =  130 bits (328), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 94/172 (54%), Gaps = 7/172 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + + W  P  R II L+ F   K LKK  R++ Y + +N AF+ VI AC+   +K P
Sbjct: 51  SDDEPLLWWSPDPRAIIELDNFVASKSLKKLARKQTYTVTLNYAFDRVIEACSSTPRKNP 110

Query: 65  TT-------WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
            T       WI   +  AY  L  +G AH++E W  + LVGGLYGV +G V+ GESMF  
Sbjct: 111 NTGELNSETWITDDMIGAYRQLNGLGLAHSVEVWDGETLVGGLYGVGIGKVYCGESMFHR 170

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
             N SK+ +  LV+H+K      +D Q  T+HL   GA  ++   + + LEN
Sbjct: 171 ESNTSKLAMMALVEHMKSHDMAFIDCQLPTDHLASLGANVLSRENFIEKLEN 222


>gi|330721865|gb|EGG99828.1| Leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium IMCC2047]
          Length = 230

 Score =  130 bits (328), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 95/172 (55%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R ++  E  H  + LKK +R+ ++ +  +  F  V+  CA+  Q +  T
Sbjct: 54  DQPILWWSPNPRCVLYPEQLHVSRSLKKTLRKNVFSVSFDQQFARVMQHCAESRQDQDGT 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   + +A+  L   G AH++E W+ D LVGGLYG+++G VFFGESMFS   +ASK+ L
Sbjct: 114 WITPDMLEAFQRLHSQGVAHSVEVWRGDELVGGLYGLAMGRVFFGESMFSRATDASKVAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
             L + L +  F L+D Q  + HL   GAI I   Q+   LE  ++ P  S 
Sbjct: 174 YQLTQQLLEWGFNLVDCQVHSEHLESLGAITIDRGQFIAHLEQHIEDPNQSL 225


>gi|254449274|ref|ZP_05062721.1| leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium HTCC5015]
 gi|198261129|gb|EDY85427.1| leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium HTCC5015]
          Length = 215

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 96/168 (57%), Gaps = 3/168 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P +R +IP E  H  + +K++++RE +    N  FE+VI AC+Q   ++ 
Sbjct: 50  SEDEPILWWTPAKRAVIPCENIHISRSMKRFLKREPFTYSHNQCFEAVIEACSQPRPQQW 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +++AYI+L   G+AH+ E W++  LVGG+YGV+ G +F GESMFS   NASK 
Sbjct: 110 GTWITEDMKQAYIELHNAGHAHSYECWEQGELVGGVYGVATGRIFSGESMFSISTNASKS 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            L H+        +  +D Q +  HLR  GA EI   ++   L   ++
Sbjct: 170 TLIHIA---HSNDYDWIDCQVMNPHLRSLGATEIDRERFVARLTQEIQ 214


>gi|328473232|gb|EGF44080.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           parahaemolyticus 10329]
          Length = 236

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +    TF   K LKK+ R+  Y + IN A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLTFKPSKSLKKFQRKHQYKVTINQATERVIQLCS-STRPADET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q AYI L  +G+ H++E W  + LVGGLYG+S+G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQAAYIQLSNLGHCHSVEVWHDNTLVGGLYGISVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL  +   L+D Q +  HL   GA E+   ++ + L
Sbjct: 173 WYLCSHLASKHGQLIDCQVMNPHLASLGAFELDRDEFIQKL 213


>gi|255523266|ref|ZP_05390237.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           carboxidivorans P7]
 gi|296186227|ref|ZP_06854632.1| leucyl/phenylalanyl-tRNA--protein transferase [Clostridium
           carboxidivorans P7]
 gi|255513134|gb|EET89403.1| leucyl/phenylalanyl-tRNA/protein transferase [Clostridium
           carboxidivorans P7]
 gi|296049495|gb|EFG88924.1| leucyl/phenylalanyl-tRNA--protein transferase [Clostridium
           carboxidivorans P7]
          Length = 219

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 97/168 (57%), Gaps = 1/168 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++  +       +KK +++  Y I  +T F  VIS CA   +K  
Sbjct: 48  SEDEPILWWSPDPRFVLYPKDIKISHSMKKILKKNTYRISFDTCFRDVISNCA-GVRKES 106

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  MGYAH++EAW +D LVGGLYG+ +G  FFGESMFS M+NASK 
Sbjct: 107 GTWITNDMIEAYCKLHNMGYAHSVEAWYEDKLVGGLYGIIIGKCFFGESMFSIMDNASKA 166

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            +  L + L++  F+L+D Q  T HL   GA+ I   ++ ++++   K
Sbjct: 167 AMIVLCQRLQQENFILVDCQVYTKHLESLGAVNIERNKFLEIVQKEAK 214


>gi|292493703|ref|YP_003529142.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitrosococcus
           halophilus Nc4]
 gi|291582298|gb|ADE16755.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitrosococcus
           halophilus Nc4]
          Length = 241

 Score =  130 bits (327), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 98/171 (57%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q I W  P  R ++  +  H  + L+K +R+  Y + ++  F  VI ACA   +    
Sbjct: 55  QGQPILWWSPDPRLVLFPKQLHISRSLRKRLRKGTYRVTLDKDFPGVIQACAGPRRDTEG 114

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   ++ AY+ L  +G AH+ E W++D L+GGLYG+S+G +FFGESMFS   +ASK+ 
Sbjct: 115 TWITAEMKNAYLRLHRIGIAHSAEVWEEDELIGGLYGLSIGRIFFGESMFSQRPDASKVA 174

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           L +L + L++  F LLD Q  + HL++ GA  ++  ++   L+     P I
Sbjct: 175 LVYLCRQLQRWGFPLLDCQIQSEHLQRLGAQTLSRNEFLHWLQQFCNSPPI 225


>gi|153003707|ref|YP_001378032.1| leucyl/phenylalanyl-tRNA--protein transferase [Anaeromyxobacter sp.
           Fw109-5]
 gi|166224658|sp|A7H8K2|LFTR_ANADF RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|152027280|gb|ABS25048.1| Leucyltransferase [Anaeromyxobacter sp. Fw109-5]
          Length = 235

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R ++  E  H    L + IRR  Y +  + AFE V+  CA + +  +  TWI
Sbjct: 53  ILWWSPDPRLVLEPERLHVSASLARTIRRGRYRVTADRAFEDVVRRCAGRARPGQDGTWI 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AY+ L  +G+AH+ EAW+ + L GGLYGVSLG  FFGESMF+   +ASK+    
Sbjct: 113 VPEMIDAYVRLHRLGFAHSFEAWEGEALAGGLYGVSLGGAFFGESMFADRPDASKVAFVR 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
            V+ L +    L+D Q  T HL +FGA EI   ++   L  AL  P +
Sbjct: 173 SVEWLARWDVRLIDCQVRTEHLARFGAREIPRAEFLARLGRALDRPTL 220


>gi|291614840|ref|YP_003524997.1| leucyl/phenylalanyl-tRNA/protein transferase [Sideroxydans
           lithotrophicus ES-1]
 gi|291584952|gb|ADE12610.1| leucyl/phenylalanyl-tRNA/protein transferase [Sideroxydans
           lithotrophicus ES-1]
          Length = 231

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 100/173 (57%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++  + F+    L+K +R   + +R ++AFE V+ ACA   + + 
Sbjct: 49  SEGEPILWWSPDPRMVLFPKEFNISHSLRKILRNGRHVVRFDSAFEQVMRACAAPREGQS 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  +  AY +L  MGYAH++E W    LVGGLYG++LG +F+GESMFS   +ASKI
Sbjct: 109 GTWIHEEMIAAYCELHRMGYAHSVETWLDGKLVGGLYGMALGRMFYGESMFSRRTDASKI 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
            L HL   L +  F ++D Q  T HL   GA EI   ++   L++ + +  ++
Sbjct: 169 ALAHLAAQLTRWNFGMIDCQMNTPHLASLGAREIPRKEFIARLQDLINYTPVT 221


>gi|309789535|ref|ZP_07684117.1| leucyl/phenylalanyl-tRNA/protein transferase [Oscillochloris
           trichoides DG6]
 gi|308228423|gb|EFO82069.1| leucyl/phenylalanyl-tRNA/protein transferase [Oscillochloris
           trichoides DG6]
          Length = 217

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 1/164 (0%)

Query: 10  ISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           + W  P  R I+PL++ FH P  +++ IRR  + +  N AF +VI+ CA    KR +TW+
Sbjct: 49  VQWYAPETRAILPLDSRFHVPTNVRRLIRRSHFTVSFNRAFRNVIAECAALRPKRESTWL 108

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +  +   Y  L  +G+AH++E W    LVGG YG+S+G  F GES+F   + ASKI L +
Sbjct: 109 SADLIAVYTKLHDLGFAHSVEVWNGANLVGGGYGISIGGFFSGESLFYREDQASKIGLVY 168

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           LV+HL++R F+L D Q  +N  RQFG IEI H +Y  LL  AL+
Sbjct: 169 LVEHLRERGFVLSDAQMPSNLTRQFGVIEIPHTEYHTLLTAALE 212


>gi|307824255|ref|ZP_07654481.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylobacter
           tundripaludum SV96]
 gi|307734635|gb|EFO05486.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylobacter
           tundripaludum SV96]
          Length = 231

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 92/168 (54%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++  +     + L+K +R+ ++ +  + AF  VI+ACA   +    T
Sbjct: 55  GEPILWWSPDPRLVLFPDNLVISRSLRKTLRKNIFSVTFDQAFNEVITACADPRKDTAGT 114

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AY  L   G+AH++E W  D LVGGLYGV+LG VFFGESMF    +ASK+  
Sbjct: 115 WITAEINAAYNQLHQAGFAHSVETWLGDELVGGLYGVALGQVFFGESMFHTRTDASKVAF 174

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV+ L    + L+D Q  T+HL  FGA EI    + KLL+     P
Sbjct: 175 ATLVQQLNAWGYRLIDCQVHTSHLESFGAQEIARDYFTKLLDQYCDIP 222


>gi|82703822|ref|YP_413388.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosospira
           multiformis ATCC 25196]
 gi|119367702|sp|Q2Y5H5|LFTR_NITMU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|82411887|gb|ABB75996.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosospira
           multiformis ATCC 25196]
          Length = 232

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           +   I W  P  R ++        + L+K +R+  Y+IR +  F  V+ ACA   +    
Sbjct: 50  DGDPILWWSPDPRMVLFPRELKVSRSLQKSLRKGNYEIRTDRNFTPVMRACAAPRRDSCG 109

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +  AY  L  MG+AH++E W    LVGGLYGV+LG VFFGESMFS + NASKI 
Sbjct: 110 TWIQNKMIFAYSALHEMGFAHSVETWMDGELVGGLYGVALGRVFFGESMFSRVSNASKIA 169

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
             HLV+ L++  F ++D Q  T HL   GA EI   ++++ L+  + + E
Sbjct: 170 FVHLVRQLERWGFEMIDCQMKTAHLASLGAREIPREEFSQRLKELVNYME 219


>gi|28897792|ref|NP_797397.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153838531|ref|ZP_01991198.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           parahaemolyticus AQ3810]
 gi|260364833|ref|ZP_05777412.1| leucyltransferase [Vibrio parahaemolyticus K5030]
 gi|260876955|ref|ZP_05889310.1| leucyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|33301266|sp|Q87QY1|LFTR_VIBPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|28806005|dbj|BAC59281.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149748098|gb|EDM58957.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           parahaemolyticus AQ3810]
 gi|308093698|gb|EFO43393.1| leucyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308113282|gb|EFO50822.1| leucyltransferase [Vibrio parahaemolyticus K5030]
          Length = 236

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +    TF   K LKK+ R+  Y + IN A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLTFKPSKSLKKFQRKHQYKVTINQATEHVIQLCS-STRPADET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q AYI L  +G+ H++E W  + LVGGLYG+S+G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQAAYIQLSNLGHCHSVEVWHDNTLVGGLYGISVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL  +   L+D Q +  HL   GA E+   ++ + L
Sbjct: 173 WYLCTHLASKHGQLIDCQVMNPHLASLGAFELDRDEFIQKL 213


>gi|330503294|ref|YP_004380163.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           mendocina NK-01]
 gi|328917580|gb|AEB58411.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           mendocina NK-01]
          Length = 226

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 99/169 (58%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  E  H  + L K +R++ Y +  +  F +VI+ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPEELHVSRSLAKLLRQQRYRVTFDQDFAAVIAACAAPRSYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q AY+ L   G AH++E W++D LVGGLYG+++G +FFGESMFS  +NASKI 
Sbjct: 111 TWITPGMQDAYLQLHQRGIAHSVEVWQEDELVGGLYGLAMGQLFFGESMFSRADNASKIG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV  L++  F+L+D Q  T HL  FGA  I   ++A  L+N L  P
Sbjct: 171 FATLVGKLQQWGFVLIDCQMPTQHLHSFGARAIPRARFADYLQNHLDLP 219


>gi|108761358|ref|YP_629568.1| leucyl/phenylalanyl-tRNA--protein transferase [Myxococcus xanthus
           DK 1622]
 gi|118572937|sp|Q1DCQ5|LFTR_MYXXD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|108465238|gb|ABF90423.1| leucyl/phenylalanyl-tRNA--protein transferase [Myxococcus xanthus
           DK 1622]
          Length = 234

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 96/171 (56%), Gaps = 1/171 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  +  H  + L+K + R +Y++R +TAF  VI+ C+Q  +   
Sbjct: 50  SEGDPILWHSPDPRFVLSPDKLHVGRSLRKTMARGIYEVRYDTAFRRVITECSQVPRPGQ 109

Query: 65  T-TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           T TWI   + +AY+ L   G+AH++EAW +  L GGLYGVSLGA FFGESMF+   +ASK
Sbjct: 110 TGTWITEEMMEAYVTLHEAGFAHSVEAWAEGELKGGLYGVSLGAAFFGESMFALAPDASK 169

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           +      +  +   F L+D Q  T HL +FGA      ++   L  A+K P
Sbjct: 170 VAFVTAAERFQGWGFQLIDCQVETEHLARFGAENWPRRRFLSALARAMKEP 220


>gi|90415918|ref|ZP_01223851.1| Leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2207]
 gi|90332292|gb|EAS47489.1| Leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2207]
          Length = 239

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 92/173 (53%), Gaps = 4/173 (2%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           +   I W  P  R ++P    H  K L+K +RR  Y + +N AF +V+ AC++  +    
Sbjct: 52  DEDPILWWSPATRCVLPPSDLHCSKSLRKTLRRNDYQVTVNQAFNTVVDACSEPREDDGG 111

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   ++ AY  L   G AH++E W +  LVGGLYGV++G++F GESMFS   +ASKI 
Sbjct: 112 TWITEEMKAAYTQLHQQGKAHSLEVWFEGNLVGGLYGVAVGSIFCGESMFSRRASASKIA 171

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHV----QYAKLLENALKHP 174
           L HL +        L+D Q +  HL   GAI I       Q +K  +  L  P
Sbjct: 172 LAHLCRWGLDAGLKLIDCQLVNPHLISLGAISIDRSIFIEQLSKSRDKGLNWP 224


>gi|307130782|ref|YP_003882798.1| leucyl/phenylalanyl-tRNA-protein transferase [Dickeya dadantii
           3937]
 gi|306528311|gb|ADM98241.1| leucyl/phenylalanyl-tRNA-protein transferase [Dickeya dadantii
           3937]
          Length = 242

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 94/162 (58%), Gaps = 2/162 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++    FH  + +KK++RR  Y + +N AFE+VISACA  +++   T
Sbjct: 53  GEPILWWCPDPRAVLFPAQFHLSRSMKKFMRRTDYRVTLNQAFEAVISACA--SEREEGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AYI L   G AH++E W+   LVGGLYG++ GA+F GESMFS  +NASK  L
Sbjct: 111 WIGRDIVHAYIQLHRSGLAHSVEVWRGAELVGGLYGIAQGALFCGESMFSRADNASKYAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
              ++H  +    L+D Q + +H    GA +I   ++   L+
Sbjct: 171 AAFMQHFVRHGGQLIDCQVLNDHTASLGACDIPRREFLHALD 212


>gi|34497253|ref|NP_901468.1| leucyl/phenylalanyl-tRNA--protein transferase [Chromobacterium
           violaceum ATCC 12472]
 gi|47115717|sp|Q7NX31|LFTR_CHRVO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|34103109|gb|AAQ59472.1| leucyltransferase [Chromobacterium violaceum ATCC 12472]
          Length = 233

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 97/171 (56%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + I W  P  R ++  +     + L K +R   Y+IR+++AF  V+ ACA+    + 
Sbjct: 49  SDGEPILWWSPAPRMVMFPDELKVSRSLAKTLRNLDYEIRVDSAFPEVMRACAEPRAGQD 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +GYAH+ E W    L GGLYGVS+G +F+GESMFS   +ASK+
Sbjct: 109 GTWIVPEMVAAYCRLHQIGYAHSFETWIDGELAGGLYGVSIGRMFYGESMFSRRRDASKL 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
              H+V+HL+ +   ++D Q  T HL   GA  I+   +   L+  ++HP+
Sbjct: 169 AFVHMVRHLQAQGVTMIDCQMHTEHLASLGARLISRDVFLATLKENVRHPQ 219


>gi|305666128|ref|YP_003862415.1| leucyl/phenylalanyl-tRNA--protein transferase [Maribacter sp.
           HTCC2170]
 gi|304420060|gb|EAQ99805.2| leucyl/phenylalanyl-tRNA--protein transferase [Maribacter sp.
           HTCC2170]
          Length = 222

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 96/161 (59%), Gaps = 1/161 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P  R ++  +     K ++K IR + + +  N  FE+VI  CA+ K Q +  TWI
Sbjct: 60  ILWWSPNPRMVLFPKRIKISKSMRKVIRNDEFKLTKNHCFEAVIDQCAKVKRQGQDGTWI 119

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +  +++AY+DL  +GYAH+ E W+ + LVGGLYG+ LG +F GESMFS + NASK     
Sbjct: 120 SKEMKEAYLDLHMLGYAHSYEVWQNEELVGGLYGIDLGHIFCGESMFSFVSNASKFAFIQ 179

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           L + L+++ + L+D Q  T+HL   GA EI   ++   L+ 
Sbjct: 180 LARELQEKNYTLIDCQLYTSHLESLGAEEIPRKKFMGFLKG 220


>gi|224369762|ref|YP_002603926.1| Aat [Desulfobacterium autotrophicum HRM2]
 gi|259494484|sp|C0QI26|LFTR_DESAH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|223692479|gb|ACN15762.1| Aat [Desulfobacterium autotrophicum HRM2]
          Length = 229

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 94/166 (56%), Gaps = 1/166 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWINM 70
           W  P  R +I        + L+K I R +Y I ++ AF  VI+ACA  + +    TW+  
Sbjct: 55  WWSPDPRLVILPGQLRVSRSLQKRINRNVYTITMDQAFGRVINACADLRNRSGQGTWLVQ 114

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLV 130
            + +AYI L   GYAH++EAW    L GGLYG+SLG  FFGESMFS M ++SK  L  L 
Sbjct: 115 EMIEAYIGLHERGYAHSVEAWNAGTLAGGLYGISLGGCFFGESMFSTMADSSKTALAALD 174

Query: 131 KHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           +HL K++F L+D Q  T+HL   G +EI    +   +  +L+   I
Sbjct: 175 RHLVKQKFDLIDCQVKTDHLVSMGGVEIPRKDFLTRIHGSLEKKTI 220


>gi|307545648|ref|YP_003898127.1| leucyl/phenylalanyl-tRNA--protein transferase [Halomonas elongata
           DSM 2581]
 gi|307217672|emb|CBV42942.1| leucyl/phenylalanyl-tRNA--protein transferase [Halomonas elongata
           DSM 2581]
          Length = 245

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 93/167 (55%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q + W  P  R ++  +     + L K +R   + +  +TAF++V+SACA   + +P
Sbjct: 50  SEGQPVLWWSPDPRMVLLPDEIRVRRSLAKRLRNGGFQVTADTAFDAVVSACAAPRRDQP 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++ AY  L  +G AH++E W    LVGGLYG++LG VFFGESMFS   +ASKI
Sbjct: 110 GTWITDEMRAAYGRLHELGPAHSVEVWHDGSLVGGLYGIALGPVFFGESMFSREADASKI 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            L  L + + +    L+D Q  T HL   GA +I   ++   LE  L
Sbjct: 170 ALVALARAMAREGGRLIDCQMHTAHLASLGARDIARAEFIGYLEQWL 216


>gi|226330742|ref|ZP_03806260.1| hypothetical protein PROPEN_04662 [Proteus penneri ATCC 35198]
 gi|225201537|gb|EEG83891.1| hypothetical protein PROPEN_04662 [Proteus penneri ATCC 35198]
          Length = 237

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 87/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++P    H  + L+K+IR   Y I +N AF SVI AC+ + +    TWI   
Sbjct: 58  WWSPDPRAVLPAGDLHIGRSLRKFIRHHPYRITLNHAFASVIEACSIRDE---GTWIGPD 114

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           I++ Y  L++ G AH++E W+ D LVGGLYGV++GAVF GESMFS  +NASK        
Sbjct: 115 IKEGYEALYHQGEAHSVEVWEGDKLVGGLYGVNIGAVFCGESMFSRRDNASKCAFIAFYN 174

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GA EI+   Y   L
Sbjct: 175 HFLRYGGQLFDCQVLNSHTASLGASEISRDHYLDAL 210


>gi|149910268|ref|ZP_01898912.1| leucyl/phenylalanyl-tRNA--protein transferase [Moritella sp. PE36]
 gi|149806628|gb|EDM66595.1| leucyl/phenylalanyl-tRNA--protein transferase [Moritella sp. PE36]
          Length = 249

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 89/154 (57%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P +R ++     H  + L+K +RR+ +   IN AF  VI +CA+       
Sbjct: 54  DGQPILWWSPSQRMVLAPGKMHISRSLRKSLRRQNFTFSINNAFAEVIESCAEPRGYSSD 113

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI  T+Q AY+ L  MG+AH+IE W++  LVGGLYG+ +G +F GESMF  + +ASKI 
Sbjct: 114 TWITDTMQDAYLQLHEMGFAHSIEVWQEGQLVGGLYGLYIGDIFCGESMFHTVTDASKIA 173

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
              L +HL      L+D Q    HL   GAIEI+
Sbjct: 174 FIALQQHLLSIGCKLIDCQLHNEHLASLGAIEIS 207


>gi|254514308|ref|ZP_05126369.1| leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium NOR5-3]
 gi|219676551|gb|EED32916.1| leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium NOR5-3]
          Length = 171

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 90/151 (59%), Gaps = 4/151 (2%)

Query: 23  LETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYM 82
           ++  H  + L+K +RR+ + +R++ +F  ++ ACA     +  TWI+  +  AY DL   
Sbjct: 4   VDELHISRSLRKTLRRDEFSLRVDHSFRELMHACAAPRDGQQGTWIDPAMIDAYSDLNAQ 63

Query: 83  GYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLD 142
           G+AH+IE W+   LVGGLYGV++G  FFGESMFS   NASK+ L  L   LK+R  L +D
Sbjct: 64  GWAHSIEVWEDHALVGGLYGVAIGGAFFGESMFSLRPNASKVALVALTWLLKQRGALFID 123

Query: 143 IQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            Q  + HL   GA  I+ V +    EN L+H
Sbjct: 124 CQLESEHLNSLGARNISRVDF----ENRLQH 150


>gi|74318061|ref|YP_315801.1| leucyl/phenylalanyl-tRNA--protein transferase [Thiobacillus
           denitrificans ATCC 25259]
 gi|119368216|sp|Q3SH93|LFTR_THIDA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|74057556|gb|AAZ97996.1| leucyl/phenylalanyl-tRNA--protein transferase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 228

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 92/170 (54%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R ++P       + L K +R   +++R+++AF  V+ AC    +    TW
Sbjct: 52  EPIQWWSPDPRMVLPPAEIRVTRSLAKRLRNAGFELRVDSAFIEVMRACGAPREGAWGTW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  +  AY  LF  GYAH+IE W+   LVGGLYGV++G +F+GESMFS   +ASK+ L 
Sbjct: 112 ISAPMIAAYGRLFDAGYAHSIETWRDGRLVGGLYGVAIGRMFYGESMFSREPDASKVALV 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
            L + L++  F L+D Q  T HL   GA  I    +   L   +  P + 
Sbjct: 172 RLARQLERWGFGLIDCQMETPHLASMGARPIPRADFTARLAELVNLPHLP 221


>gi|254512100|ref|ZP_05124167.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacteraceae
           bacterium KLH11]
 gi|221535811|gb|EEE38799.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodobacteraceae
           bacterium KLH11]
          Length = 210

 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 103/172 (59%), Gaps = 4/172 (2%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+  +   + W+ P  RG+ PL+ FH  + L + IR   Y I I+  F +V+  CA   
Sbjct: 19  MAEHRDDPKLFWVDPKFRGVFPLDGFHISRSLARRIRSCGYRITIDRDFAAVVDGCAD-- 76

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             R  TWIN  +++ Y +L   G AH++E W+ + LVGG+YGV LGA FFGESMFS   +
Sbjct: 77  --RADTWINPELRRLYAELHQGGRAHSLEVWEDNTLVGGVYGVVLGAAFFGESMFSRRTD 134

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           ASKI L +LV  L++  F+L D QF+T HL   GAIE+    Y   L+ A+K
Sbjct: 135 ASKIALAYLVDRLRQTGFILFDTQFLTAHLASLGAIELPRATYHSELKQAVK 186


>gi|262361401|gb|ACY58122.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           D106004]
          Length = 182

 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + ++++IR   Y   +N AF  VISACA  T++   TWI 
Sbjct: 2   ILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACA--TERDEGTWIG 59

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYGV++GAVF GESMFS  +NASK  L   
Sbjct: 60  RDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVF 119

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  +    L+D Q +  H    GA+EI
Sbjct: 120 CHHFTQHGGELIDCQVLNAHTASLGAVEI 148


>gi|16330203|ref|NP_440931.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechocystis sp.
           PCC 6803]
 gi|33301223|sp|P73571|LFTR_SYNY3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|1652691|dbj|BAA17611.1| Leu/Phe-tRNA-protein transferase [Synechocystis sp. PCC 6803]
          Length = 198

 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 96/174 (55%), Gaps = 7/174 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +   + W    R  +IPL+  F  PK L++ + +  + ++IN AF +V   CA  
Sbjct: 19  MAD--DRHGLGWYSSDRHALIPLDDQFRYPKSLQRVLNQNRFQVKINQAFTAVCEGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              RP TWI+  + + Y      G+AH+ E W  D L GG+ G+++   F GESMF  + 
Sbjct: 75  --ARPETWISQELIEVYHTFHVAGWAHSFETWHGDRLAGGILGIAIRGAFIGESMFYTIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            ASK+ +  LV+HL++R + L D Q    HL++FGA E+    Y K LE AL +
Sbjct: 133 EASKVAMVKLVQHLRQRSYQLFDAQLQNPHLKRFGAYEVEEKAYKKQLEKALNY 186


>gi|227356769|ref|ZP_03841154.1| leucyl/phenylalanyl-tRNA-protein transferase [Proteus mirabilis
           ATCC 29906]
 gi|227163059|gb|EEI47994.1| leucyl/phenylalanyl-tRNA-protein transferase [Proteus mirabilis
           ATCC 29906]
          Length = 235

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 86/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++P  T H  + L+K++R+  Y I +N AF  VI AC+ + +    TWI   
Sbjct: 63  WWSPDPRAVLPAGTLHIGRTLRKFLRQAPYTITLNQAFSDVIEACSVRNEG---TWIGPD 119

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           I+  Y  L   G AH++E W+ D LVGGLYGV++GAVF GESMFS   NASK        
Sbjct: 120 IKTGYRALHQQGEAHSVEVWEGDELVGGLYGVNVGAVFCGESMFSRRNNASKCAFVAFYN 179

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GAIEI   +Y + L
Sbjct: 180 HFLRYGGQLFDCQVLNSHTAALGAIEIARDRYLEAL 215


>gi|269963098|ref|ZP_06177433.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio harveyi 1DA3]
 gi|269832062|gb|EEZ86186.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio harveyi 1DA3]
          Length = 236

 Score =  127 bits (320), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 89/152 (58%), Gaps = 1/152 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +    +F   K LKK+ R++ Y + +N A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLSFKPSKSLKKFQRKQQYKVTLNNATERVIQLCS-STRPAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +YI+L   G+ H++E W +D LVGGLYG+S+G +F GESMFS  +NASKI L
Sbjct: 113 WLNEDMQTSYIELAKHGHCHSVEVWHEDQLVGGLYGISVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
            +L  HL      L+D Q +  HL   GA E+
Sbjct: 173 WYLCDHLASNHGQLIDCQVMNPHLASLGAFEL 204


>gi|332142540|ref|YP_004428278.1| leucyl/phenylalanyl-tRNA-protein transferase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327552562|gb|AEA99280.1| leucyl/phenylalanyl-tRNA-protein transferase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 248

 Score =  127 bits (320), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 93/172 (54%), Gaps = 7/172 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + + W  P  R II L  F   K LKK  R++ Y + IN AF+ VI+AC+   +K P
Sbjct: 51  SDDEPLLWWSPNPRAIIELNEFVPSKSLKKLARKQKYTVTINHAFDRVINACSAIPRKNP 110

Query: 65  TT-------WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
            T       WI   +  AY  L  +G  H++E W  D LVGGLYGV +G V+ GESMF  
Sbjct: 111 NTGDFSDETWITEDMIAAYKQLNGLGLVHSVEVWHDDELVGGLYGVGIGKVYCGESMFHR 170

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
             N SK+ +  LV+H+K      +D Q  T+HL   GA  ++   + + LEN
Sbjct: 171 ESNTSKLAMLALVEHMKAYDMAFIDCQLPTDHLSSLGAKTLSREDFIEKLEN 222


>gi|238920379|ref|YP_002933894.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Edwardsiella ictaluri 93-146]
 gi|259494487|sp|C5BE98|LFTR_EDWI9 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|238869948|gb|ACR69659.1| leucyl/phenylalanyl-tRNA--protein transferase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 242

 Score =  127 bits (320), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 94/161 (58%), Gaps = 2/161 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  +  H    L+K +RR    I +N AF +VI+ CA+  Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLVPQALHISHSLRKALRRTTLRITLNQAFAAVIAGCAE--QRAEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +IQ+AY  L  +G+AH++E W+++ LVGGLYGV+ G++F GESMFS + NASK+ L   
Sbjct: 114 PSIQQAYCQLHQLGHAHSVEVWQEERLVGGLYGVAQGSLFCGESMFSRVSNASKMALWSF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
             H ++    L+D Q +  H    GA +I   +Y + L N 
Sbjct: 174 CSHFQRMGGQLIDCQVLNAHTASLGAHDIPRRRYLQHLLNC 214


>gi|77166054|ref|YP_344579.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosococcus oceani
           ATCC 19707]
 gi|254436338|ref|ZP_05049844.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosococcus oceani
           AFC27]
 gi|119367703|sp|Q3J7Z7|LFTR_NITOC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|76884368|gb|ABA59049.1| Leucyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|207088028|gb|EDZ65301.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosococcus oceani
           AFC27]
          Length = 240

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 93/170 (54%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R I+  +  H  + L K +RR +Y + ++  F  VI ACA   Q    T
Sbjct: 56  GQPILWWSPDPRLILFPQQLHISRSLHKRLRRGIYQVTLDLDFPGVIQACASPRQDGEGT 115

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   ++ AY  L  MG AH++E W+   L+GGLYGVS+G +FFGESMFS   +ASKI  
Sbjct: 116 WITSEMKSAYNRLHEMGIAHSVETWEDKELIGGLYGVSIGRIFFGESMFSKRPDASKIAF 175

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
            +L + L++  F L+D Q  + HL++ GA  +   ++   L      P +
Sbjct: 176 VYLCRQLQRWGFPLIDCQIQSEHLQRLGAQTLPRNKFLHWLHEFSNSPSL 225


>gi|148241643|ref|YP_001226800.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           RCC307]
 gi|147849953|emb|CAK27447.1| Leu/Phe-tRNA-protein transferase [Synechococcus sp. RCC307]
          Length = 202

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 94/158 (59%), Gaps = 5/158 (3%)

Query: 18  RGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAY 76
           R +IPL+  FH P+ L++ +R   +++++N+AF +V+  CA     RP+TWI++ ++  Y
Sbjct: 31  RALIPLDQRFHVPRSLRRQLRPGRFELKLNSAFAAVVDGCA----DRPSTWISLELRAIY 86

Query: 77  IDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKR 136
            +L  +G+AH+IEAW    L GG  G+++G  + GESMF    +AS + L  L   L++ 
Sbjct: 87  QELHRLGWAHSIEAWDAHGLAGGQLGLAIGRCWIGESMFHSRPHASNVVLVQLQSALRQG 146

Query: 137 QFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            F L D+Q    HL +FG  E++   Y   L  A++ P
Sbjct: 147 GFELFDVQLSNPHLERFGCFELSDADYTSCLAKAVQQP 184


>gi|156973860|ref|YP_001444767.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio harveyi ATCC
           BAA-1116]
 gi|166224675|sp|A7N1L9|LFTR_VIBHB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|156525454|gb|ABU70540.1| hypothetical protein VIBHAR_01570 [Vibrio harveyi ATCC BAA-1116]
          Length = 236

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +     F   K LKK+ R++ Y + +N A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLAFKPSKSLKKFQRKQQYKVTLNNATERVIQLCS-STRSAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +YI+L   G+ H++E W  + L+GGLYG+S+G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQTSYIELARRGHCHSVEVWHDEKLIGGLYGISVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L +HL   Q  L+D Q +  HL   GA E+    + + L
Sbjct: 173 WYLCEHLASNQGQLIDCQVMNPHLASLGAFELERDDFVQKL 213


>gi|88860140|ref|ZP_01134779.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudoalteromonas
           tunicata D2]
 gi|88818134|gb|EAR27950.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudoalteromonas
           tunicata D2]
          Length = 252

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 92/172 (53%), Gaps = 1/172 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N  D I W  P +R II LE FH  + LKK + +  + + IN  F  V+  C ++     
Sbjct: 66  NDDDPIMWWSPSQRAIIELEEFHVSRSLKKSLNKHPFKVFINRDFAEVMYQCQRQRIHHE 125

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  +  AY  L  MG+AH+IE W  D LVGGLYG+ LGAVF GESMF  M N SK+
Sbjct: 126 GTWISDEMLDAYTTLHKMGHAHSIEIWLNDQLVGGLYGIMLGAVFCGESMFHTMPNTSKL 185

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
               LV  LK+ Q   +D Q +  H    GA  I+  +Y   L   + H ++
Sbjct: 186 ASWALVNWLKRNQGAFIDCQVLNPHTASLGAKAISRDEYLSRLSTQMTHIDL 237


>gi|258543979|ref|ZP_05704213.1| leucyltransferase [Cardiobacterium hominis ATCC 15826]
 gi|258520757|gb|EEV89616.1| leucyltransferase [Cardiobacterium hominis ATCC 15826]
          Length = 216

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 90/165 (54%), Gaps = 4/165 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R IIP    HT + L+K++RR  Y + ++TAF + I  CA        TWI 
Sbjct: 49  ILWWSPDPRAIIPTAAIHTSRSLRKHMRRMTYRLTLDTAFTATIDHCASSHG---ATWIT 105

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++  Y+ L   G AH+ E W+ D LVGGLYGV+L  +F GESM+S   +ASKI L  L
Sbjct: 106 PVMRATYLTLHEQGRAHSCELWQDDELVGGLYGVALERIFCGESMYSLRPSASKIVLVQL 165

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY-AKLLENALKH 173
              L       LD QF+T HL   GAI I    Y A+L +N  KH
Sbjct: 166 CAWLAAHGIDTLDTQFLTPHLISMGAIAIPRRDYLARLTDNPDKH 210


>gi|269139550|ref|YP_003296251.1| Leu/Phe-tRNA-protein transferase [Edwardsiella tarda EIB202]
 gi|267985211|gb|ACY85040.1| Leu/Phe-tRNA-protein transferase [Edwardsiella tarda EIB202]
 gi|304559438|gb|ADM42102.1| Leucyl/phenylalanyl-tRNA--protein transferase [Edwardsiella tarda
           FL6-60]
          Length = 247

 Score =  127 bits (319), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 90/154 (58%), Gaps = 2/154 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  +  H    L+K +RR    I +N  F +VI+ CA+  Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLAPQALHVSHSLRKALRRTALRITLNQDFAAVIAGCAE--QRAEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +IQ+AY  L  +G+AH++E W++D LVGGLYGV+ G++F GESMFS + NASK+ L   
Sbjct: 114 PSIQQAYCQLHQLGHAHSVEVWQEDRLVGGLYGVAQGSLFCGESMFSRVSNASKMALWSF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
             H ++    L+D Q +  H    GA +I   +Y
Sbjct: 174 CSHFQRMGGQLIDCQVLNAHTASLGAHDIPRRRY 207


>gi|119945918|ref|YP_943598.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychromonas
           ingrahamii 37]
 gi|158513117|sp|A1SWY4|LFTR_PSYIN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119864522|gb|ABM03999.1| Leucyltransferase [Psychromonas ingrahamii 37]
          Length = 238

 Score =  127 bits (319), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 84/150 (56%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ Q I W  P +R II     H    +KK I +  + + IN AF  VI ACA     + 
Sbjct: 53  SDGQPILWWSPSQRAIIQPNLVHISSSMKKIISKNNFSLSINHAFHDVIDACAAPRGNQN 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L   G AH+IE W+ + LVGGLYGV +G+VF GESMFS  +N SKI
Sbjct: 113 ETWITFDMIAAYQKLHQQGIAHSIEVWRDNKLVGGLYGVCIGSVFCGESMFSKEDNTSKI 172

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFG 154
               L +H  K +  L+D Q +T HL+ FG
Sbjct: 173 AFIALCQHFDKFKGQLIDCQILTKHLQSFG 202


>gi|152997264|ref|YP_001342099.1| leucyltransferase [Marinomonas sp. MWYL1]
 gi|150838188|gb|ABR72164.1| Leucyltransferase [Marinomonas sp. MWYL1]
          Length = 247

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 93/164 (56%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++   I W  P +R  +  + FH  K LKK I+++ +   +N  FESVI  C+     + 
Sbjct: 60  SDPDPILWWHPEQRCTLNPDHFHISKSLKKAIKKDQWLFSVNQEFESVIGYCSALRADKE 119

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  I+ AY  L  +GYAH+IE W K+ LVGG YG+++G +FFGESMFS + NASKI
Sbjct: 120 GTWISTDIKNAYTKLHKLGYAHSIEIWHKNKLVGGFYGIAMGNMFFGESMFSLVPNASKI 179

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            L    +  K     L+D Q  ++HL   GA ++    +   LE
Sbjct: 180 ALKKFCELTKDCGIELIDCQVESDHLLSLGAKKMPRENFCDALE 223


>gi|167948610|ref|ZP_02535684.1| leucyl/phenylalanyl-tRNA--protein transferase [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 236

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 95/166 (57%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E     + L+K + R+ + I  +  FE+VI ACA+     P TW+ 
Sbjct: 54  ILWWSPDPRMVLYPEKLKISRSLRKRLARKEFQISFDRQFEAVIRACAEPRTTSPGTWLA 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AYI+      AH++E W+ ++LVGGLYG+++GAVFFGESMFS + +ASK  L  L
Sbjct: 114 EEMIQAYIECHRRALAHSVEVWQGEMLVGGLYGIAIGAVFFGESMFSRVSDASKCALVRL 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
            + L    F L+D Q  T+HL   GA  I   ++++ L+     P+
Sbjct: 174 TQQLTAWGFELIDCQVYTSHLASLGAETIPRKRFSQALDQGCILPD 219


>gi|51595736|ref|YP_069927.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108812770|ref|YP_648537.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Nepal516]
 gi|145599596|ref|YP_001163672.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Pestoides F]
 gi|149366628|ref|ZP_01888662.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           pestis CA88-4125]
 gi|153950469|ref|YP_001401568.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162420163|ref|YP_001606108.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Angola]
 gi|165924573|ref|ZP_02220405.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938953|ref|ZP_02227506.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166009862|ref|ZP_02230760.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166211456|ref|ZP_02237491.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167400047|ref|ZP_02305565.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419420|ref|ZP_02311173.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167424225|ref|ZP_02315978.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|170024915|ref|YP_001721420.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186894813|ref|YP_001871925.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928519|ref|YP_002346394.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           CO92]
 gi|229841338|ref|ZP_04461497.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229843442|ref|ZP_04463588.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229895815|ref|ZP_04510985.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           Pestoides A]
 gi|229903183|ref|ZP_04518296.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           Nepal516]
 gi|270486976|ref|ZP_06204050.1| leucyltransferase [Yersinia pestis KIM D27]
 gi|294503361|ref|YP_003567423.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Z176003]
 gi|33301315|sp|Q8ZGD2|LFTR_YERPE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|61213377|sp|Q66CK7|LFTR_YERPS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119368220|sp|Q1CGE3|LFTR_YERPN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|158514100|sp|A4TN37|LFTR_YERPP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166990811|sp|A7FJZ0|LFTR_YERP3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737731|sp|B2KA03|LFTR_YERPB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737732|sp|A9R4Y8|LFTR_YERPG RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737733|sp|B1JRF9|LFTR_YERPY RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|51589018|emb|CAH20636.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776418|gb|ABG18937.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           Nepal516]
 gi|115347130|emb|CAL20023.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           pestis CO92]
 gi|145211292|gb|ABP40699.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           Pestoides F]
 gi|149291002|gb|EDM41077.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           pestis CA88-4125]
 gi|152961964|gb|ABS49425.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352978|gb|ABX86926.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Angola]
 gi|165913100|gb|EDR31724.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165923633|gb|EDR40765.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165991258|gb|EDR43559.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166207227|gb|EDR51707.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166962161|gb|EDR58182.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050755|gb|EDR62163.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057074|gb|EDR66837.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169751449|gb|ACA68967.1| Leucyltransferase [Yersinia pseudotuberculosis YPIII]
 gi|186697839|gb|ACC88468.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678953|gb|EEO75056.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           Nepal516]
 gi|229689789|gb|EEO81850.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229697704|gb|EEO87751.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229700738|gb|EEO88767.1| leucyl/phenylalanyl-tRNA-protein transferase [Yersinia pestis
           Pestoides A]
 gi|262365062|gb|ACY61619.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           D182038]
 gi|270335480|gb|EFA46257.1| leucyltransferase [Yersinia pestis KIM D27]
 gi|294353820|gb|ADE64161.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Z176003]
          Length = 236

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + ++++IR   Y   +N AF  VISACA  T++   TWI 
Sbjct: 56  ILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACA--TERDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYGV++GAVF GESMFS  +NASK  L   
Sbjct: 114 RDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  +    L+D Q +  H    GA+EI
Sbjct: 174 CHHFTQHGGELIDCQVLNAHTASLGAVEI 202


>gi|167470477|ref|ZP_02335181.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           FV-1]
          Length = 234

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + ++++IR   Y   +N AF  VISACA  T++   TWI 
Sbjct: 56  ILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACA--TERDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYGV++GAVF GESMFS  +NASK  L   
Sbjct: 114 RDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  +    L+D Q +  H    GA+EI
Sbjct: 174 CHHFTQHGGELIDCQVLNAHTASLGAVEI 202


>gi|120598601|ref|YP_963175.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sp.
           W3-18-1]
 gi|146293320|ref|YP_001183744.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           putrefaciens CN-32]
 gi|158512979|sp|A1RIX6|LFTR_SHESW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166224673|sp|A4Y7L2|LFTR_SHEPC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|120558694|gb|ABM24621.1| Leucyltransferase [Shewanella sp. W3-18-1]
 gi|145565010|gb|ABP75945.1| Leucyltransferase [Shewanella putrefaciens CN-32]
          Length = 236

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 93/163 (57%), Gaps = 1/163 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N+ D I W  P  R I  L        L KY++++ +   IN AF SV++ CA+   K+ 
Sbjct: 52  NADDPILWWSPDPRAIFMLGKIRISTSLCKYLKKQPWHFTINHAFTSVMAGCAEPRPKQN 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L   G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITDEIQMAYRELHQNGHAHSIEVWEGEQLIGGLYGLAIGQVFCGESMFHRQTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  L +HL KR F L+D Q +  HL   GA  I    + +LL
Sbjct: 172 AIVVLQQHLIKRGFKLIDAQVMNPHLESLGAKAIKRTHFIELL 214


>gi|226940357|ref|YP_002795431.1| LftR [Laribacter hongkongensis HLHK9]
 gi|254809120|sp|C1D7I2|LFTR_LARHH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226715284|gb|ACO74422.1| LftR [Laribacter hongkongensis HLHK9]
          Length = 233

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 86/168 (51%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + + W  P  R ++     H P+ L+K +R   Y + ++ AF SVI ACA  T  RP +
Sbjct: 51  GEPVLWWSPDPRMVLYPAELHVPRSLEKVLRHRRYTVTVDRAFGSVIRACAAPTPARPAS 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I   Y  L+ +G AH++E W    L GG YGV +G +F+GESMF+   +ASKI  
Sbjct: 111 WITPEIISTYSQLYRLGLAHSVETWIDGQLAGGFYGVMIGRMFYGESMFAQAPDASKIAF 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            HL++        ++D Q  T HL +FG  EI    +   +      P
Sbjct: 171 AHLMRRFAGHGIDMIDCQMHTAHLARFGGREIPRSDFVATVNTLTAQP 218


>gi|254228989|ref|ZP_04922410.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. Ex25]
 gi|151938457|gb|EDN57294.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. Ex25]
          Length = 235

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 94/161 (58%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +     F   K LKK+ R+  Y + +N A E VI  C+  T++   T
Sbjct: 54  GEPILWWSPSPRAVFDPLAFKPSKSLKKFQRKHNYKVTLNFATEEVIRLCS-STRRAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +YI+L  +G+ H++E W  + L+GGLYG+ +G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQASYIELAKLGHCHSVEVWHDNELIGGLYGICVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL  +Q  L+D Q + +HL   GA E+   ++ + L
Sbjct: 173 WYLCNHLASKQGQLIDCQVMNSHLASLGAFELERNEFMQKL 213


>gi|238784510|ref|ZP_04628518.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia bercovieri
           ATCC 43970]
 gi|238714573|gb|EEQ06577.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia bercovieri
           ATCC 43970]
          Length = 236

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 90/149 (60%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++R   Y   +N AFE V+ ACA  +Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLFPEDLHVSRSMRRFLRHCPYRFTLNHAFEDVVRACA--SQRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY +L  +G+AH++E W ++ LVGGLYG+++GA+F GESMFS  +NASK  L   
Sbjct: 114 DDVQQAYCELHALGHAHSVEVWLENKLVGGLYGIAVGALFCGESMFSRADNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  ++   L+D Q +  H    GAIEI
Sbjct: 174 CHHFTRQGGELIDCQVLNAHTASLGAIEI 202


>gi|197284587|ref|YP_002150459.1| leucyl/phenylalanyl-tRNA--protein transferase [Proteus mirabilis
           HI4320]
 gi|226737708|sp|B4EV85|LFTR_PROMH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|194682074|emb|CAR41621.1| leucyl/phenylalanyl-tRNA-protein transferase [Proteus mirabilis
           HI4320]
          Length = 230

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++P  T H  + L+K++R+  Y I +N AF  VI AC+ + +    TWI   
Sbjct: 58  WWSPDPRAVLPAGTLHIGRTLRKFLRQAPYTITLNQAFSDVIEACSVRDEG---TWIGPD 114

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           I+  Y  L   G AH++E W+ D L+GGLYGV++GAVF GESMFS   NASK        
Sbjct: 115 IKTGYRALHQQGEAHSVEVWEGDELIGGLYGVNVGAVFCGESMFSRRNNASKCAFVAFYN 174

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GAIEI   +Y + L
Sbjct: 175 HFLRYGGQLFDCQVLNSHTAALGAIEIARDRYLEAL 210


>gi|22126683|ref|NP_670106.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis KIM
           10]
 gi|45441049|ref|NP_992588.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|21959700|gb|AAM86357.1|AE013884_4 leucyl, phenylalanyl-tRNA-protein transferase [Yersinia pestis KIM
           10]
 gi|45435908|gb|AAS61465.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           pestis biovar Microtus str. 91001]
          Length = 244

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + ++++IR   Y   +N AF  VISACA  T++   TWI 
Sbjct: 64  ILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACA--TERDEGTWIG 121

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYGV++GAVF GESMFS  +NASK  L   
Sbjct: 122 RDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVF 181

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  +    L+D Q +  H    GA+EI
Sbjct: 182 CHHFTQHGGELIDCQVLNAHTASLGAVEI 210


>gi|237653256|ref|YP_002889570.1| leucyl/phenylalanyl-tRNA--protein transferase [Thauera sp. MZ1T]
 gi|237624503|gb|ACR01193.1| leucyl/phenylalanyl-tRNA/protein transferase [Thauera sp. MZ1T]
          Length = 235

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 97/165 (58%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++  + FH    L+K +RR  +++R +TAF  V+ ACA      P
Sbjct: 49  SEGEPILWWTPDPRLVLVPDEFHVSHSLRKTLRRRRFEVRTDTAFAEVLLACAAARAGGP 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++ AY  +  +G+AH++E W++  LVGGLYG+++G VFFGESMF+   +ASK+
Sbjct: 109 GTWITPAMRAAYQRMHELGWAHSVECWREGRLVGGLYGMAIGRVFFGESMFARETDASKV 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            L HL + L +R + ++D Q  T HL   GA E+   ++   L  
Sbjct: 169 ALAHLARLLAERGYGMIDCQMTTAHLCSLGAREVPRARFTAALRQ 213


>gi|304397054|ref|ZP_07378933.1| leucyl/phenylalanyl-tRNA/protein transferase [Pantoea sp. aB]
 gi|304355203|gb|EFM19571.1| leucyl/phenylalanyl-tRNA/protein transferase [Pantoea sp. aB]
          Length = 230

 Score =  127 bits (318), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++  R  Y + +N +F+ VI  CA  T +   TWI 
Sbjct: 56  ILWWSPDPRAVLLPEQFHLSRSMKRFHSRSPYRVTMNESFDEVIEGCA--TGREEGTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +++A++ L+ +G+AH+IE W +  LVGG+YG+++G +F GESMFS  +NASK  L   
Sbjct: 114 FEMKRAWLRLYELGHAHSIEVWDEHQLVGGMYGLAMGQIFCGESMFSRQQNASKTALWVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +H  + Q  L+D Q +  H    GA EI    Y + +++    P
Sbjct: 174 CQHFIRHQGRLVDCQVLNPHTASLGAQEIPRADYLQYVQSLASQP 218


>gi|33602947|ref|NP_890507.1| leucyl/phenylalanyl-tRNA--protein transferase [Bordetella
           bronchiseptica RB50]
 gi|47115746|sp|Q7WGE6|LFTR_BORBR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|33568578|emb|CAE34336.1| putative leucyl/phenylalanyl-tRNA--protein transferase [Bordetella
           bronchiseptica RB50]
          Length = 254

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIR---RELYD------IRINTAFESVISA 55
           A  + I W  P  R ++    F     L+K +R   R  +D      +R++TAF  V+  
Sbjct: 50  AEGEPILWWSPDPRMVLACADFAPSHSLRKRLRALARTEHDPAARLQVRVDTAFARVLHE 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA     +P TWI+  +Q+AY      G+ H+IE W    L GGLYGVSLG +F+GESMF
Sbjct: 110 CAAPRHGQPGTWISPAVQQAYRSWHAAGFVHSIETWIDGELAGGLYGVSLGRMFYGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           +   +ASKI L HLV  L++ Q   +D Q  T HL + GA  +   ++ + + +A+  P 
Sbjct: 170 ARATDASKIALAHLVAFLRRHQVAWIDCQQQTGHLARLGARPVPRARFIEHIAHAVAQPR 229

Query: 176 ISF 178
           + +
Sbjct: 230 LPW 232


>gi|94987061|ref|YP_594994.1| leucyl/phenylalanyl-tRNA--protein transferase [Lawsonia
           intracellularis PHE/MN1-00]
 gi|119367699|sp|Q1MQQ4|LFTR_LAWIP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|94731310|emb|CAJ54673.1| Leu/Phe-tRNA-protein transferase [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 228

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 94/159 (59%), Gaps = 1/159 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRP 64
           N+  I W  P  R I+  E F  PK +++ +++  + + IN AF  VI+ACA   + K+ 
Sbjct: 49  NNSPILWWSPDPRCILLPENFRIPKTIQRELKKCTFSVTINNAFTEVITACATLPRTKQK 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++ AYI L  +G++H+IE W    LVGGLYGV+LG  FFGESMF    +ASK+
Sbjct: 109 GTWITQDMKMAYIQLHKLGFSHSIEVWDNSTLVGGLYGVALGKAFFGESMFHIAPHASKL 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            L  L ++L    F  +D Q  T H+ ++GA  I+  ++
Sbjct: 169 ALVWLAQYLWSYNFDFIDCQMPTTHIMRYGATLISRNEF 207


>gi|325273418|ref|ZP_08139671.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas sp.
           TJI-51]
 gi|324101445|gb|EGB99038.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas sp.
           TJI-51]
          Length = 154

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 88/146 (60%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIE 89
           + L K +R+  Y +  ++ F +VI ACA        TWI  T++ AY +L   G AH++E
Sbjct: 2   RSLAKLMRQGRYQVSFDSDFPAVIDACAAPRDYADGTWITDTMRNAYCELHRRGIAHSVE 61

Query: 90  AWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNH 149
             +   LVGGLYG+++G +FFGESMFS  +NASK+    LV+HL++  F+L+D Q  TNH
Sbjct: 62  VRQHGELVGGLYGLAMGQLFFGESMFSRADNASKVGFVTLVEHLRQAGFVLIDCQMPTNH 121

Query: 150 LRQFGAIEITHVQYAKLLENALKHPE 175
           L   GA  I+  ++A+ L   L  P 
Sbjct: 122 LHSLGAHAISRAEFARYLARHLDQPN 147


>gi|238795833|ref|ZP_04639346.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia mollaretii
           ATCC 43969]
 gi|238720296|gb|EEQ12099.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia mollaretii
           ATCC 43969]
          Length = 216

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 89/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++RR  Y   +N AFE V+ ACA  +Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLFPEDLHVSRSMRRFLRRCPYRFTLNHAFEDVVRACA--SQRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY +L  +G+AH++E W ++ LVGGLYG+++G +F GESMFS  +NASK  L   
Sbjct: 114 DDVQRAYCELHALGHAHSVEVWLENELVGGLYGIAVGTLFCGESMFSRSDNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H   +   L+D Q +  H    GAIEI
Sbjct: 174 CHHFTHQGGELIDCQVLNAHTASLGAIEI 202


>gi|24374165|ref|NP_718208.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           oneidensis MR-1]
 gi|33301294|sp|Q8EDW8|LFTR_SHEON RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|24348672|gb|AAN55652.1|AE015704_3 leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           oneidensis MR-1]
          Length = 236

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 95/163 (58%), Gaps = 1/163 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N++D I W  P  R I      +    L+KY++++ +   IN AF  V++ CAQ  +K+ 
Sbjct: 52  NAEDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWRFTINHAFTDVMAGCAQPRRKQA 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH+IE W+ + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITHEIQMAYRELHHNGHAHSIEVWQGERLIGGLYGLAIGQVFCGESMFHRETNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  L +HL K  F L+D Q +  HL   GA  +    + +LL
Sbjct: 172 AMAVLQQHLIKMNFKLIDAQVMNPHLESLGAKALKRADFIQLL 214


>gi|108806658|ref|YP_650574.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia pestis
           Antiqua]
 gi|119368219|sp|Q1CA93|LFTR_YERPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|108778571|gb|ABG12629.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           pestis Antiqua]
          Length = 261

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 88/150 (58%), Gaps = 2/150 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + ++++IR   Y   +N AF  VISACA  T++   TWI 
Sbjct: 56  ILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACA--TERDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYGV++GAVF GESMFS  +NASK  L   
Sbjct: 114 RDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
             H  +    L+D Q +  H    GA+EI 
Sbjct: 174 CHHFTQHGGELIDCQVLNAHTASLGAVEIP 203


>gi|33598055|ref|NP_885698.1| leucyl/phenylalanyl-tRNA--protein transferase [Bordetella
           parapertussis 12822]
 gi|47115743|sp|Q7W4W8|LFTR_BORPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|33574484|emb|CAE38822.1| putative leucyl/phenylalanyl-tRNA--protein transferase [Bordetella
           parapertussis]
          Length = 254

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIR---RELYD------IRINTAFESVISA 55
           A  + I W  P  R ++    F     L+K +R   R  +D      +R++TAF  V+  
Sbjct: 50  AEGEPILWWSPDPRMVLACADFAPSHSLRKRLRALARTEHDPAARLQVRVDTAFARVLHE 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA     +P TWI+  +Q+AY      G+ H+IE W    L GGLYGVSLG +F+GESMF
Sbjct: 110 CAAPRHGQPGTWISPAVQQAYHSWHAAGFVHSIETWIDGELAGGLYGVSLGRMFYGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           +   +ASKI L HLV  L++ Q   +D Q  T HL + GA  +   ++ + + +A+  P 
Sbjct: 170 ARATDASKIALAHLVAFLRRHQVAWIDCQQQTGHLARLGARPVPRARFIEHIAHAVAQPR 229

Query: 176 ISF 178
           + +
Sbjct: 230 LPW 232


>gi|150003221|ref|YP_001297965.1| leucyl/phenylalanyl-tRNA--protein transferase [Bacteroides vulgatus
           ATCC 8482]
 gi|254884990|ref|ZP_05257700.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp.
           4_3_47FAA]
 gi|294776009|ref|ZP_06741505.1| leucyltransferase [Bacteroides vulgatus PC510]
 gi|319640392|ref|ZP_07995116.1| Leu/Phe-tRNA-protein transferase [Bacteroides sp. 3_1_40A]
 gi|149931645|gb|ABR38343.1| Leu/Phe-tRNA-protein transferase [Bacteroides vulgatus ATCC 8482]
 gi|254837783|gb|EET18092.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp.
           4_3_47FAA]
 gi|294450147|gb|EFG18651.1| leucyltransferase [Bacteroides vulgatus PC510]
 gi|317387995|gb|EFV68850.1| Leu/Phe-tRNA-protein transferase [Bacteroides sp. 3_1_40A]
          Length = 217

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 92/165 (55%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  PL+R +I     H    ++ ++ +E Y +  N AF  VI  C     +    W
Sbjct: 51  KQIQWWCPLKRFVIFPNEIHISHSMRTFMNKEQYGVSFNQAFHEVIQTCGNLRMEETGAW 110

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           +   I KAYI L   G+A ++E W++  LVGGLYGV+LG  FFGESMFS + NASK+ L 
Sbjct: 111 LGKDIMKAYIRLHEQGFATSVEVWEESCLVGGLYGVTLGKCFFGESMFSLVPNASKLALI 170

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +L +  ++    L+D QF T HL+  G   I + +Y + ++  L+
Sbjct: 171 YLAQTFQELGGTLIDCQFETPHLKSMGGRYIDYEEYMRYVQEPLE 215


>gi|307729491|ref|YP_003906715.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           CCGE1003]
 gi|307584026|gb|ADN57424.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           CCGE1003]
          Length = 245

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 104/179 (58%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGII-PLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+ P E   +P   K LK+ +R + ++IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLKRVLREDAWEIRVDQDFPAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   +  AY  L  MG AH+IE W +   VGGLYGVSLG +FFGESMF+++ 
Sbjct: 112 RRGQRGTWITADVVDAYSSLHRMGDAHSIETWFEGERVGGLYGVSLGKMFFGESMFANVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASK+ L  LV HL+  +  ++D Q  T+HL   G  EI    +   +  ++  P I +
Sbjct: 172 DASKMALAALVGHLRGHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVDAPPIPW 230


>gi|163753398|ref|ZP_02160522.1| leu/phe-tRNA-protein transferase [Kordia algicida OT-1]
 gi|161327130|gb|EDP98455.1| leu/phe-tRNA-protein transferase [Kordia algicida OT-1]
          Length = 209

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 92/155 (59%), Gaps = 1/155 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           +  + I W  P  R ++  +     K +K+ +RRE + +  N AF  VI ACA  +   +
Sbjct: 46  SEGEPIIWWSPDPRMVLFPDDLKVSKSMKQLLRRETFTVTYNQAFRHVIRACALIERPGQ 105

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI + +++AYI+L   G+A ++E W+ D LVGG+YG+ LG +F GESMFS   NASK
Sbjct: 106 DDTWITVEMEEAYIELHEKGHATSVEVWRDDKLVGGIYGIDLGHIFCGESMFSFESNASK 165

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
               HLV+HLK+    L+D Q  T+HL   GA E+
Sbjct: 166 FGFIHLVQHLKQNGCQLIDCQMHTDHLASLGAYEV 200


>gi|271500834|ref|YP_003333859.1| leucyl/phenylalanyl-tRNA/protein transferase [Dickeya dadantii
           Ech586]
 gi|270344389|gb|ACZ77154.1| leucyl/phenylalanyl-tRNA/protein transferase [Dickeya dadantii
           Ech586]
          Length = 242

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 7   SQD--ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           SQD  I W  P  R ++    FH  + ++K++RR  Y + +N AFE+VISACA  +++  
Sbjct: 51  SQDDPILWWCPDPRAVLFPAQFHLSRSMRKFMRRADYRVTLNQAFEAVISACA--SEREE 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I + Y  L   G AH++E W  + LVGGLYG++ GA+F GESMFS + NASK 
Sbjct: 109 GTWIGEEIIRTYCQLHSAGVAHSVEVWHGEHLVGGLYGIAQGALFCGESMFSRVNNASKY 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            LT  ++H       L+D Q + +H    GA +I   ++   L+  L+H
Sbjct: 169 ALTTFLQHFVHHGGQLIDCQVLNDHTASLGATDIPRREFLHWLQQ-LQH 216


>gi|59712369|ref|YP_205145.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio fischeri
           ES114]
 gi|75431584|sp|Q5E3Y9|LFTR_VIBF1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|59480470|gb|AAW86257.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio fischeri
           ES114]
          Length = 239

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 88/164 (53%), Gaps = 1/164 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +N   I W  P  RG+   E F   K LKK+ R+  Y++ +N A   VI  CA  T+ + 
Sbjct: 54  SNGDPILWWSPSVRGVFFPEQFSPSKSLKKFFRKSNYNVTLNKATYQVIDLCAS-TRPKE 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +GY H++E W +D L+GGLYG+ +G +F GESMFS   NASKI
Sbjct: 113 ETWIMPEMINAYKKLANLGYCHSVEVWNEDELIGGLYGLQIGQIFCGESMFSLQTNASKI 172

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            L    +H       L+D Q +  HL   GA E+    +  LLE
Sbjct: 173 ALWKFCEHFVSFNGKLIDCQMMNPHLESLGAKEMKRCDFKTLLE 216


>gi|329298243|ref|ZP_08255579.1| leucyl/phenylalanyl-tRNA--protein transferase [Plautia stali
           symbiont]
          Length = 213

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 93/165 (56%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+F+  + + ++ RR  Y + +N AF  V+  CA   Q+   TWI 
Sbjct: 39  ILWWSPDPRAVLLPESFNLSRSMARFHRRSPYRVTMNHAFAQVVEGCASGRQE--GTWIT 96

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +++A++ L+ + +AH+IE W+   LVGG+YG++LG +F GESMFS  ENASK  L   
Sbjct: 97  FEVKRAWLRLYELDHAHSIEVWQDQRLVGGMYGLALGQIFCGESMFSRAENASKTALWVF 156

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +H    Q  L+D Q +  H    GA+EI  V Y + ++     P
Sbjct: 157 SQHFIAHQGRLIDCQVLNPHTASLGAVEIPRVDYLQYVQTLAWQP 201


>gi|83718814|ref|YP_443028.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           thailandensis E264]
 gi|167620189|ref|ZP_02388820.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           thailandensis Bt4]
 gi|257139257|ref|ZP_05587519.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           thailandensis E264]
 gi|119367691|sp|Q2SVM1|LFTR_BURTA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|83652639|gb|ABC36702.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           thailandensis E264]
          Length = 255

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 101/181 (55%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++ 
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGGMFFGESMYAD 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           + +ASKI L  LV HL++ + +++D Q  T+HL   G  EI    +   +  A+  P IS
Sbjct: 170 VSDASKIALAALVAHLREHRVVMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIS 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|262394724|ref|YP_003286578.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. Ex25]
 gi|262338318|gb|ACY52113.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. Ex25]
          Length = 235

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +     F   K LKK+ R+  Y + +N A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLAFKPSKSLKKFQRKHNYKVTLNFATEEVIRLCS-STRPAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +YI+L  +G+ H++E W  + L+GGLYG+ +G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQASYIELAKLGHCHSVEVWHDNELIGGLYGICVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL  +Q  L+D Q + +HL   GA E+   ++ + L
Sbjct: 173 WYLCNHLASKQGQLIDCQVMNSHLASLGAFELERNEFMQKL 213


>gi|87311287|ref|ZP_01093409.1| leucyl/phenylalanyl-tRNA--protein transferase [Blastopirellula
           marina DSM 3645]
 gi|87286027|gb|EAQ77939.1| leucyl/phenylalanyl-tRNA--protein transferase [Blastopirellula
           marina DSM 3645]
          Length = 235

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 93/165 (56%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           ++W     R II L   H  +RL + +R   +    + AF  V+  CA++ +    TWI 
Sbjct: 49  MTWFSLDPRAIIELNDLHVSRRLARTLRSGQFTATCDQAFPDVMRGCARRRKGGDGTWIT 108

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + KA+ +L   G+AH++E W+ + L GG+YGV++G  F GESMF ++ +ASK+ L  L
Sbjct: 109 PHLFKAFCNLHEEGHAHSVEVWQGEELAGGIYGVAVGGAFAGESMFHNVTDASKVALATL 168

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           V HL  R + L DIQ  T H    GA EI    Y K L +A+++P
Sbjct: 169 VAHLNVRGYRLFDIQQWTPHTGSMGACEIPRHIYLKRLADAVRYP 213


>gi|291296108|ref|YP_003507506.1| leucyl/phenylalanyl-tRNA/protein transferase [Meiothermus ruber DSM
           1279]
 gi|290471067|gb|ADD28486.1| leucyl/phenylalanyl-tRNA/protein transferase [Meiothermus ruber DSM
           1279]
          Length = 202

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 96/159 (60%), Gaps = 2/159 (1%)

Query: 18  RGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT-TWINMTIQKA 75
           R ++PL E FH P+ L++ +    +++RI+  FE V+  CA +     + TW+   + + 
Sbjct: 39  RALMPLDERFHIPRSLRRVLNSRRFEVRIDHDFEGVLEGCATRGWTYSSETWLTPEVAEL 98

Query: 76  YIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKK 135
           Y  L   G+AH+ E W  + L GG+ G++LGA F G+SMF  + NASK+ +  LV+HL+ 
Sbjct: 99  YRSLHRYGFAHSFETWCGNQLAGGILGIALGAAFIGDSMFYSIPNASKVAMVRLVEHLRA 158

Query: 136 RQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           R F + D+Q    HL +FGAIE+  +++ + L  A++ P
Sbjct: 159 RGFEIFDVQVQNPHLARFGAIEVDPLEFRQRLWRAIQKP 197


>gi|289642804|ref|ZP_06474941.1| leucyl/phenylalanyl-tRNA/protein transferase [Frankia symbiont of
           Datisca glomerata]
 gi|289507373|gb|EFD28335.1| leucyl/phenylalanyl-tRNA/protein transferase [Frankia symbiont of
           Datisca glomerata]
          Length = 312

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 93/168 (55%), Gaps = 3/168 (1%)

Query: 3   DSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK 62
           D+    DI+W  P   G++P+     P+ L K +R   +   ++ AF  V+  C Q T++
Sbjct: 99  DARGRADIAWWSPDPHGVLPIGGVRVPESLFKRMRACDWTTTLDQAFADVVHNCGQGTRR 158

Query: 63  RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
              TWI   +  AY +L  +G+AH++E W+ D L+GG++GV +GAVF  ESMF    +AS
Sbjct: 159 ---TWITTELAGAYQELHRLGWAHSVEVWQDDELIGGMFGVLVGAVFMAESMFHVRTDAS 215

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           K+ L             L+D+QF+T H +  GA+EI  V++  +L  A
Sbjct: 216 KVALVDFDARFAPVGGRLVDVQFVTAHAKSMGAVEIPRVRFLTVLRQA 263


>gi|269967657|ref|ZP_06181707.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio alginolyticus
           40B]
 gi|269827744|gb|EEZ82028.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio alginolyticus
           40B]
          Length = 235

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +     F   K LKK+ R+  Y + +N A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLQFKPSKSLKKFQRKHNYKVTLNFATEEVIRLCS-STRPAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +YI+L  +G+ H++E W  + L+GGLYG+ +G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQASYIELAKLGHCHSVEVWHDNNLIGGLYGICVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL  +Q  L+D Q + +HL   GA E+   ++ + L
Sbjct: 173 WYLCNHLASKQGQLIDCQVMNSHLASLGAFELERDEFMQKL 213


>gi|30250151|ref|NP_842221.1| leucyl/phenylalanyl-tRNA--protein transferase [Nitrosomonas
           europaea ATCC 19718]
 gi|33301252|sp|Q82ST5|LFTR_NITEU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|30139258|emb|CAD86131.1| Leucyl/phenylalanyl-tRNA--protein transferase [Nitrosomonas
           europaea ATCC 19718]
          Length = 236

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 92/164 (56%), Gaps = 2/164 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++        + L K +++  Y IR ++AF  V+ ACA   + +  TWI+
Sbjct: 54  ILWWSPDPRMVLFPRELKISRSLHKTLKKNDYQIRTDSAFTEVMQACAAPREDQAGTWIH 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L  MG AH++E W +  L GGLYGV++G  FFGESMFS   +ASKI L HL
Sbjct: 114 EEMIAAYTALHQMGVAHSVETWIEGELAGGLYGVAIGRAFFGESMFSRATDASKIALVHL 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE--NAL 171
            + L+   + L+D Q  T HL   GA EI   Q++K L   NAL
Sbjct: 174 ARQLENWGYGLIDCQMKTAHLMSMGAREIPRSQFSKRLNQLNAL 217


>gi|300726154|ref|ZP_07059611.1| leucyltransferase [Prevotella bryantii B14]
 gi|299776624|gb|EFI73177.1| leucyltransferase [Prevotella bryantii B14]
          Length = 219

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 95/164 (57%), Gaps = 2/164 (1%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISAC--AQKTQKR 63
           ++ DI W  P++R +I     H    +K+ IR   Y +  N AF+ VI  C  AQ   ++
Sbjct: 52  DAPDIMWFCPMKRFVIIPGEAHVSHSMKQLIRSGKYRVTFNKAFDEVIQGCSKAQNRIEQ 111

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
              W+   + +AY +L++ G+A ++E W  D LVGGLYGV+LG  FFGESMFS   +ASK
Sbjct: 112 EGAWLGEDMIQAYTELYHQGFAASVEVWNGDKLVGGLYGVTLGRAFFGESMFSLEPSASK 171

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           + L +L   +K R   ++D Q  T HL+  GA  I + +Y +L+
Sbjct: 172 LALIYLSNMMKDRGGTVIDCQLETPHLKSMGAKYIDYDEYLRLI 215


>gi|238792418|ref|ZP_04636052.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia intermedia
           ATCC 29909]
 gi|238728344|gb|EEQ19864.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia intermedia
           ATCC 29909]
          Length = 259

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 89/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++RR  Y + +N AF  V+ ACA  +Q+   TWI 
Sbjct: 79  ILWWSPDPRAVLFPEDLHISRSMRRFLRRCPYHLTLNHAFADVVKACA--SQRDEGTWIG 136

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYG+++G +F GESMFS  +NASK  L   
Sbjct: 137 EDVQQAYCQLHALGHAHSVEVWLENELVGGLYGIAMGKLFCGESMFSRADNASKSALMVF 196

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  ++   L+D Q +  H    GAIEI
Sbjct: 197 CHHFTRQGGELIDCQVLNAHTASLGAIEI 225


>gi|220935176|ref|YP_002514075.1| leucyl/phenylalanyl-tRNA/protein transferase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996486|gb|ACL73088.1| leucyl/phenylalanyl-tRNA/protein transferase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 236

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 98/172 (56%), Gaps = 3/172 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R ++        + L+K +R   + +  + AFE VI  CA+       T
Sbjct: 56  GQPILWWSPDPRTVLFSAEVKVSRSLRKTLRSGRFRVSFDEAFEQVIKGCAEPRGGVHGT 115

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +Q+A+I +   G+AH++E W++D LVGGLYGVSLG +F+GESMFS + +ASK+ L
Sbjct: 116 WITYGMQQAFIHMHQAGFAHSVEVWQEDQLVGGLYGVSLGRMFYGESMFSRVSDASKVAL 175

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE---NALKHPE 175
             L +HL+   + L+D Q  + HL + GA  +   ++ + L+   +   HPE
Sbjct: 176 VTLCRHLEHWGYPLIDSQTPSAHLARMGARPMPRNEFRQWLDRLCDQPPHPE 227


>gi|260779209|ref|ZP_05888101.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605373|gb|EEX31668.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 240

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 96/172 (55%), Gaps = 14/172 (8%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT--TWIN 69
           W  P  R +   +TF   K LKK+ ++  Y I IN A E+VI  CA     RP   TW+N
Sbjct: 60  WWSPSPRAVFDPKTFKPAKSLKKFQKKHQYQISINLATEAVIDHCASM---RPEHETWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ +Y  L  +G+ H++E WK + L+GGLYG+S+G VF GESMFS   NASK+ L + 
Sbjct: 117 EEMRASYKKLATLGHCHSVEVWKDEALIGGLYGLSIGQVFCGESMFSRETNASKVALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY---------AKLLENALK 172
            +H K  +  L+D Q +  HL+  GA E+    +          K++EN+ K
Sbjct: 177 CEHFKSMKGQLIDCQVMNPHLKSLGAQELDRDDFMQSLLSLRQEKVVENSFK 228


>gi|251789964|ref|YP_003004685.1| leucyl/phenylalanyl-tRNA/protein transferase [Dickeya zeae Ech1591]
 gi|247538585|gb|ACT07206.1| leucyl/phenylalanyl-tRNA/protein transferase [Dickeya zeae Ech1591]
          Length = 242

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 92/159 (57%), Gaps = 2/159 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           A  + I W  P  R ++    FH  + ++K+IRR  Y + +N AFE+VI+ACA + ++  
Sbjct: 51  APGEPILWWCPDPRAVLFPAQFHLSRSMRKFIRRTDYQVTLNQAFEAVIAACADEREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I + Y  L   G AH++E W  + LVGGLYG++ GA+F GESMFS  +NASK 
Sbjct: 109 GTWIGDDIMQTYCRLHESGLAHSVEVWLGEQLVGGLYGIAQGALFCGESMFSRADNASKY 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            L   ++H  +    L+D Q + +H    GA +I   ++
Sbjct: 169 ALATFLQHFVRHGGQLIDCQVLNDHTASLGACDIPRREF 207


>gi|91228215|ref|ZP_01262197.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio alginolyticus
           12G01]
 gi|91188204|gb|EAS74505.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio alginolyticus
           12G01]
          Length = 235

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +     F   K LKK+ R+  Y + +N A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLQFKPSKSLKKFQRKHNYKVTLNFATEEVIRLCS-STRPAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +YI+L  +G+ H++E W  + L+GGLYG+ +G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQTSYIELAKLGHCHSVEVWHDNNLIGGLYGICVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL  +Q  L+D Q + +HL   GA E+   ++ + L
Sbjct: 173 WYLCNHLASKQGQLIDCQVMNSHLASLGAFELERDEFMQKL 213


>gi|322832168|ref|YP_004212195.1| leucyl/phenylalanyl-tRNA/protein transferase [Rahnella sp. Y9602]
 gi|321167369|gb|ADW73068.1| leucyl/phenylalanyl-tRNA/protein transferase [Rahnella sp. Y9602]
          Length = 244

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R I+     H  + LK+++R+  +   +N  FE VI ACA   Q+   TWI 
Sbjct: 56  ILWWSPDPRAILVPGERHASRSLKRFMRKMPFRFTLNQQFEQVIHACA--MQREDGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+ Y +L   G AH++E W+ D LVGGLYGVS+G +F GESMFS  ENASK  L   
Sbjct: 114 PLVQRGYQELHEAGRAHSVEVWEGDELVGGLYGVSVGGLFCGESMFSRRENASKCALMLF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +H  +    L+D Q +  H    GA EI   Q+ + L
Sbjct: 174 CQHFSRNGGELIDCQVLNPHTASLGAREIPRRQFLQQL 211


>gi|326335632|ref|ZP_08201819.1| leucyltransferase [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325692398|gb|EGD34350.1| leucyltransferase [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 226

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 95/163 (58%), Gaps = 2/163 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPT 65
            + I W  P +R ++  E +  PK ++  + R+L+ +  N  F  VIS C    +K +  
Sbjct: 48  DEPIIWWAPPKRMVVYPEHYKVPKSMRNILNRKLFTVTFNQNFFQVISFCKNIFRKDQQG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG-AVFFGESMFSHMENASKI 124
           TWI   I  AY  L  +G AH++E W+   LVGGLYGV LG  +F GESMFS + NASK+
Sbjct: 108 TWITDEIVTAYTRLHDLGLAHSVEVWQDQQLVGGLYGVDLGNGIFCGESMFSKVSNASKV 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               L+K +K+R++LLLD Q   +HL   G+ EI   +Y K+L
Sbjct: 168 AFFTLLKWMKERKYLLLDCQIYNDHLANLGSKEIPRTEYMKIL 210


>gi|117920203|ref|YP_869395.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sp.
           ANA-3]
 gi|158512319|sp|A0KW20|LFTR_SHESA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|117612535|gb|ABK47989.1| Exopolyphosphatase [Shewanella sp. ANA-3]
          Length = 236

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 1/163 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N+ D I W  P  R I      +    L+KY++++ +   IN AF  V++ CAQ  +K+ 
Sbjct: 52  NADDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWRFTINHAFTDVMAGCAQPRRKQA 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH++E W  + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITHEIQMAYRELHHNGHAHSVEVWHGERLIGGLYGIAIGQVFCGESMFHRETNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  L +HL K  F L+D Q +  HL   GA  +    + +LL
Sbjct: 172 AMAVLQQHLIKMNFKLIDAQVMNPHLESLGAKPVKRADFIQLL 214


>gi|84496136|ref|ZP_00994990.1| Leucyl/phenylalanyl-tRNA--protein transferase [Janibacter sp.
           HTCC2649]
 gi|84382904|gb|EAP98785.1| Leucyl/phenylalanyl-tRNA--protein transferase [Janibacter sp.
           HTCC2649]
          Length = 228

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 97/175 (55%), Gaps = 6/175 (3%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
            ++ I W  P  RG++    F   + L K   R  ++IR++TAF  V+  CA    +R  
Sbjct: 57  GTRPIGWWSPEPRGVLVPGGFRERRSLTKS--RARFEIRVDTAFADVMRRCADP--EREG 112

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
            WI   I  AY +L  +G+AH++E W++  LVGGLYGV++G +F GESMF    +ASK+ 
Sbjct: 113 RWITDEIIAAYTELHRLGWAHSVETWREGELVGGLYGVAIGGLFAGESMFHAERDASKVA 172

Query: 126 LTHLVK--HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           L  LV   H    +  ++D+Q+ T HL + G +E     Y   L  AL+ P ++F
Sbjct: 173 LAVLVDIVHADGDERRIIDVQWATEHLERLGVVEWPRASYLAALGQALQAPPVAF 227


>gi|325526327|gb|EGD03934.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia sp.
           TJI49]
          Length = 255

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 100/179 (55%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGI-IPLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I +P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPTEFKVSPSLKKTLKRVLREPAWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGVS G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYAEVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL+++   ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALAALVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|256822678|ref|YP_003146641.1| leucyl/phenylalanyl-tRNA/protein transferase [Kangiella koreensis
           DSM 16069]
 gi|256796217|gb|ACV26873.1| leucyl/phenylalanyl-tRNA/protein transferase [Kangiella koreensis
           DSM 16069]
          Length = 241

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 95/172 (55%), Gaps = 4/172 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
              + I W  P  R +  L+  H  + L++ + +  Y I IN AF  V+  CA     +P
Sbjct: 52  CEDEPILWWSPDPRCVFMLDEIHVSRSLRRELNKARYTITINRAFGQVMQQCAAPRADQP 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWK----KDVLVGGLYGVSLGAVFFGESMFSHMEN 120
            TWI   +Q+AYI L   G AH+IE W+    +++LVGG+YGVS+G  FFGESMFS   N
Sbjct: 112 ETWILPEMQQAYIKLHQQGLAHSIEVWENIDGEELLVGGMYGVSIGRFFFGESMFSRRPN 171

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            SKI L +L   LK+  F ++D Q    HL + GA ++   ++  LL+  + 
Sbjct: 172 TSKIALVYLAHTLKQAGFSMIDAQVGNPHLYRMGARDMAREEFLWLLKQEIN 223


>gi|206559977|ref|YP_002230741.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           cenocepacia J2315]
 gi|226736114|sp|B4E8N6|LFTR_BURCJ RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|198036018|emb|CAR51911.1| putative leucyl/phenylalanyl-tRNA--protein transferase
           [Burkholderia cenocepacia J2315]
          Length = 254

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 101/179 (56%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGI-IPLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I +P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLREPDWEVRVDHDFPGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGVS G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL+++   ++D Q  T+HL   G  EI    +   + +A+  P I +
Sbjct: 172 DASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPW 230


>gi|270159552|ref|ZP_06188208.1| leucyl/phenylalanyl-tRNA-protein transferase [Legionella
           longbeachae D-4968]
 gi|289165651|ref|YP_003455789.1| leucyl/phenylalanyl-tRNA-protein transferase [Legionella
           longbeachae NSW150]
 gi|269987891|gb|EEZ94146.1| leucyl/phenylalanyl-tRNA-protein transferase [Legionella
           longbeachae D-4968]
 gi|288858824|emb|CBJ12738.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Legionella
           longbeachae NSW150]
          Length = 223

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 97/165 (58%), Gaps = 1/165 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           + W  P  R I+    F+  + LKK +++E +   I+TAF+ VI+ACA  + +   TWI 
Sbjct: 50  VLWWSPNPRLILIPNEFNLSQSLKKSLKKE-FTCTIDTAFKQVITACATCSNRVNNTWIT 108

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY +L  +G+AH+ E W  + LVGGLYG++LG  FFGESMF  + +ASKI + +L
Sbjct: 109 EEMIEAYTNLHRLGFAHSFEIWYANNLVGGLYGINLGRAFFGESMFHKITDASKIAIYYL 168

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            K L    F  +D Q  TNHL+  GA  I   ++  LL   L +P
Sbjct: 169 CKTLTDWNFDFIDCQIPTNHLQSLGAKVIDRKEFLYLLNKTLIYP 213


>gi|187923722|ref|YP_001895364.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           phytofirmans PsJN]
 gi|226736117|sp|B2T3H9|LFTR_BURPP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|187714916|gb|ACD16140.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia
           phytofirmans PsJN]
          Length = 245

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 103/179 (57%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R ++    F     L+K +RR L    ++IR++  F SV+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMVLRPAEFKVAPSLRKTLRRVLREDAWEIRVDHDFASVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   + +AY  L  +G AH+IE W +   VGGLYGVS G +FFGESMF+ + 
Sbjct: 112 RRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGKRVGGLYGVSFGKMFFGESMFAEVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASK+ L  LV HL++ +  ++D Q  T+HL   G  EIT   +   +  +++ P I +
Sbjct: 172 DASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREITRKSFIAHVRASVEAPPIPW 230


>gi|157962350|ref|YP_001502384.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella pealeana
           ATCC 700345]
 gi|189046562|sp|A8H5L2|LFTR_SHEPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|157847350|gb|ABV87849.1| Leucyltransferase [Shewanella pealeana ATCC 700345]
          Length = 236

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 92/158 (58%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +         + L KY++++ +   IN AFE+V + CA+    +  TWI+
Sbjct: 57  ILWWSPDPRAVFVPGNMKISRSLVKYLKKQNWTYTINHAFEAVTAGCAEPRAGQDGTWIS 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             IQ+AY+ L + G+AH++E W+ + L+GGLYG+++G VF GESMF    NASK  +  L
Sbjct: 117 SEIQQAYLSLHHQGHAHSLEVWQNNELIGGLYGLAIGQVFCGESMFHRTTNASKAAMIVL 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +HL++  F L+D Q +  HL   GA  I    + +LL
Sbjct: 177 QQHLQRCGFKLIDAQVVNPHLDSLGAKSIKRDDFLRLL 214


>gi|118572938|sp|Q6LT10|LFTR_PHOPR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 237

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (53%), Gaps = 1/163 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +N + I W  P  R I     F   K L+K+ R+  Y I +N A   VI  CA   +   
Sbjct: 53  SNGEPILWWSPAPRAIFLPNEFKPSKSLRKFYRKSGYQITLNNACHDVIRQCA-NCRSPE 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  +  +G+ H++E W +D LVGG YG+ +G+VF GESMFS  +NASKI
Sbjct: 112 ETWITEDMIQAYQTMHNLGHCHSVEVWHQDKLVGGFYGLQIGSVFCGESMFSLADNASKI 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +H   +   L+D Q + NHL   GA+EI    + + L
Sbjct: 172 ALWFFCRHFSNQGGTLIDCQVMNNHLESLGALEIPRAPFMQQL 214


>gi|117618258|ref|YP_856391.1| leucyl/phenylalanyl-tRNA--protein transferase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|158512299|sp|A0KJE0|LFTR_AERHH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|117559665|gb|ABK36613.1| leucyl/phenylalanyl-tRNA--protein transferase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 235

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 91/167 (54%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q + W  P  RG+I  E  H  + L+K+IR   +DI I+ AF  VI+ACA   +    TW
Sbjct: 56  QPLLWWSPDPRGVIRPEQLHIGRTLRKFIRGTSFDISIDRAFNEVIAACAAPRRSASGTW 115

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  +  AY  L  +G+AH+IE W++  L  GLYG+SLG VF GESMFS ++N +K+ + 
Sbjct: 116 ISTPMIDAYRQLHRLGHAHSIEIWQEGQLQAGLYGLSLGRVFCGESMFSRIDNGAKLAMV 175

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L +H  +    L+D Q   + L   G  E    Q+   L    + P
Sbjct: 176 ALCQHFARHDGALIDCQMQNDFLATLGIEEWPRRQFLTTLAQLSRQP 222


>gi|54308348|ref|YP_129368.1| leucyl/phenylalanyl-tRNA--protein transferase [Photobacterium
           profundum SS9]
 gi|46912776|emb|CAG19566.1| hypothetical leucyl/phenylalanyl-tRNA-proteintransferase
           [Photobacterium profundum SS9]
          Length = 240

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (53%), Gaps = 1/163 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +N + I W  P  R I     F   K L+K+ R+  Y I +N A   VI  CA   +   
Sbjct: 56  SNGEPILWWSPAPRAIFLPNEFKPSKSLRKFYRKSGYQITLNNACHDVIRQCA-NCRSPE 114

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  +  +G+ H++E W +D LVGG YG+ +G+VF GESMFS  +NASKI
Sbjct: 115 ETWITEDMIQAYQTMHNLGHCHSVEVWHQDKLVGGFYGLQIGSVFCGESMFSLADNASKI 174

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +H   +   L+D Q + NHL   GA+EI    + + L
Sbjct: 175 ALWFFCRHFSNQGGTLIDCQVMNNHLESLGALEIPRAPFMQQL 217


>gi|182416701|ref|ZP_02948101.1| leucyl/phenylalanyl-tRNA--protein transferase [Clostridium
           butyricum 5521]
 gi|237668449|ref|ZP_04528433.1| leucyltransferase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182379426|gb|EDT76920.1| leucyl/phenylalanyl-tRNA--protein transferase [Clostridium
           butyricum 5521]
 gi|237656797|gb|EEP54353.1| leucyltransferase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 216

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 89/161 (55%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R II  +     K ++K IR+  + +  N  FE VIS C    +    T
Sbjct: 50  GEPIMWWSPRPRFIIKPDEICISKSMRKIIRKSQFKVTFNNDFEGVISNCKSMRENNEGT 109

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   ++ AYI+LF  GYA ++E +  D LVGGLYGV +G  +FGESMFS + NASKI L
Sbjct: 110 WITDDMKDAYINLFNNGYAVSVETYLDDELVGGLYGVVIGRCYFGESMFSKVSNASKIAL 169

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             L + LK++ F  +D Q  T HL   GA  +   ++  +L
Sbjct: 170 ITLAEVLKEQNFEFIDCQVYTEHLESMGARMVEWDEFKAML 210


>gi|56750927|ref|YP_171628.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus
           elongatus PCC 6301]
 gi|56685886|dbj|BAD79108.1| Leu/Phe-tRNA-protein transferase [Synechococcus elongatus PCC 6301]
          Length = 226

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 103/175 (58%), Gaps = 6/175 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +S D+ W +   R +IPL+  F  P+ L++ + ++ ++  I+  F   I+ CA  
Sbjct: 33  MADE-DSSDLGWYRSRDRCLIPLDNRFRYPRSLRRVLNQQRFEFAISRDFLGTIAGCA-- 89

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              RP+TWI+  + + Y  L   G+A + EAW+ D LVGG+ GV++G++F GESMF H  
Sbjct: 90  --DRPSTWISDELAEIYQQLQRYGWALSWEAWQGDRLVGGILGVAIGSLFIGESMFYHEP 147

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            ASK  L  LV+ L++  + + D+Q    HL +FG+  ++  QY+  ++ A+  P
Sbjct: 148 EASKAALATLVQALQQGGWQVFDVQLTNPHLERFGSFCVSDRQYSAQIQTAIARP 202


>gi|262274507|ref|ZP_06052318.1| leucyl/phenylalanyl-tRNA--protein transferase [Grimontia hollisae
           CIP 101886]
 gi|262221070|gb|EEY72384.1| leucyl/phenylalanyl-tRNA--protein transferase [Grimontia hollisae
           CIP 101886]
          Length = 238

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R +I   TF   + LKK++R++ Y + +N AFE VI  CA   +     WI   
Sbjct: 61  WWSPAERAVIDPSTFVPARSLKKFVRKQGYRVSVNQAFEQVIQHCA-LIRGEHQVWITPE 119

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           ++ AY  L  +G AH++E W++  L+GGLYGV++G +F GESMFS   NASK  L +  +
Sbjct: 120 MRDAYTRLHRLGSAHSVEVWQEGELIGGLYGVNVGTLFCGESMFSLKTNASKTALWYFCE 179

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           H K+    ++D Q +T+HL   GA  +    + +L+E+
Sbjct: 180 HFKRGGGQMIDCQMMTDHLASLGAKSMPRDTFVQLVED 217


>gi|317047541|ref|YP_004115189.1| leucyl/phenylalanyl-tRNA/protein transferase [Pantoea sp. At-9b]
 gi|316949158|gb|ADU68633.1| leucyl/phenylalanyl-tRNA/protein transferase [Pantoea sp. At-9b]
          Length = 230

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 95/168 (56%), Gaps = 2/168 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+FH  + + ++ R+  Y + +N AF  V+  CA   Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLLPESFHLSRSMARFHRQSPYRVTMNQAFAQVLEGCASNRQE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +++A++ L+ +G+AH++E W +  LVGGLYG++LG +F GESMFS  ENASK  L   
Sbjct: 114 FEVKRAWLRLYELGHAHSVEVWHEQRLVGGLYGLALGQIFCGESMFSRQENASKTALWVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
            +H  +    L+D Q +  H    GA++I    Y + ++     P ++
Sbjct: 174 SQHFLQHHGRLIDCQVLNPHTASLGAVDIPRGDYLQYVQTLAWQPVLA 221


>gi|76810136|ref|YP_333377.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 1710b]
 gi|76579589|gb|ABA49064.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 1710b]
          Length = 412

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 209 SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 266

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 267 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 326

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 327 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 386

Query: 178 F 178
           +
Sbjct: 387 W 387


>gi|81299417|ref|YP_399625.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus
           elongatus PCC 7942]
 gi|81168298|gb|ABB56638.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus
           elongatus PCC 7942]
          Length = 226

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 103/175 (58%), Gaps = 6/175 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +S D+ W +   R +IPL+  F  P+ L++ + ++ ++  I+  F   I+ CA  
Sbjct: 33  MADE-DSSDLGWYRSRDRCLIPLDNRFRYPRSLRRVLNQQRFEFAISRDFLGTIAGCA-- 89

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              RP+TWI+  + + Y  L   G+A + EAW+ D LVGG+ GV++G++F GESMF H  
Sbjct: 90  --DRPSTWISDELAEIYQQLQRYGWALSWEAWQGDRLVGGILGVAIGSLFIGESMFYHEP 147

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            ASK  L  LV+ L++  + + D+Q    HL +FG+  ++  QY+  ++ A+  P
Sbjct: 148 EASKAALVTLVQALQQGGWQVFDVQLTNPHLERFGSFCVSDRQYSAQIQTAIARP 202


>gi|107022629|ref|YP_620956.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           cenocepacia AU 1054]
 gi|116689578|ref|YP_835201.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           cenocepacia HI2424]
 gi|118572931|sp|Q1BWM2|LFTR_BURCA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|158512285|sp|A0K731|LFTR_BURCH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|105892818|gb|ABF75983.1| Leucyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116647667|gb|ABK08308.1| Leucyltransferase [Burkholderia cenocepacia HI2424]
          Length = 254

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 102/179 (56%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGI-IPLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I +P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLRAPEWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGVS G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  L+ HL++++  ++D Q  T+HL   G  EI    +   + +A+  P I +
Sbjct: 172 DASKIALAALIAHLREQRLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPW 230


>gi|90413216|ref|ZP_01221211.1| hypothetical leucyl/phenylalanyl-tRNA-protein transferase
           [Photobacterium profundum 3TCK]
 gi|90325768|gb|EAS42226.1| hypothetical leucyl/phenylalanyl-tRNA-protein transferase
           [Photobacterium profundum 3TCK]
          Length = 237

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (53%), Gaps = 1/163 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +N + I W  P  R I     F   K L+K+ R+  Y I +N A   VI  CA   +   
Sbjct: 53  SNGEPILWWSPAPRAIFLPNEFKPSKSLRKFYRKSGYQITLNNACHDVIRQCA-DCRSPE 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  +  +G+ H++E W +D LVGG YG+ +G+VF GESMFS  +NASKI
Sbjct: 112 ETWITEDMIQAYQTMHNLGHCHSVEVWHQDKLVGGFYGLQIGSVFCGESMFSLADNASKI 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +H   +   L+D Q + NHL   GA+EI    + + L
Sbjct: 172 ALWFFCRHFSDQGGTLIDCQVMNNHLESLGALEIPRAPFMQQL 214


>gi|317125118|ref|YP_004099230.1| leucyl/phenylalanyl-tRNA/protein transferase [Intrasporangium
           calvum DSM 43043]
 gi|315589206|gb|ADU48503.1| leucyl/phenylalanyl-tRNA/protein transferase [Intrasporangium
           calvum DSM 43043]
          Length = 225

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 99/171 (57%), Gaps = 6/171 (3%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
            ++ I W  P  RGI+ +      + L+K   R  ++IR++TAFE V+ AC     +R  
Sbjct: 53  GAEPIGWWSPDPRGILRMGDLRVTRSLRK--SRAKFEIRVDTAFEQVVLACGDP--RRSG 108

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
            WI   I +AY+ L   G+AH+IE W+   LVGGLYGV++G +F GESMF  + +ASK+ 
Sbjct: 109 RWITPRIVEAYVHLHEAGWAHSIETWQAGQLVGGLYGVAIGGLFAGESMFHAVRDASKVA 168

Query: 126 LTHLVKHLKK--RQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           L  L + L +      L+D+Q+ T+HL   G  E+   +Y +LL  AL+ P
Sbjct: 169 LVGLHELLAQDGDPRRLIDVQWQTDHLATLGVTEVPRDEYRRLLAVALEAP 219


>gi|197334586|ref|YP_002156584.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio fischeri
           MJ11]
 gi|226737727|sp|B5FG61|LFTR_VIBFM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|197316076|gb|ACH65523.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio fischeri
           MJ11]
          Length = 239

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 88/164 (53%), Gaps = 1/164 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++   I W  P  RG+   E F   K LKK+ R+  Y++ +N A   VI  CA  T+ + 
Sbjct: 54  SDGDPILWWSPSVRGVFFPEQFSPSKSLKKFFRKSNYNVTLNKATYQVIDLCA-STRPKE 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + KAY  L  +GY H++E W  + L+GGLYG+ +G VF GESMFS   NASKI
Sbjct: 113 ETWIMPEMIKAYKTLVDLGYCHSVEVWNDNELIGGLYGLQIGQVFCGESMFSLQTNASKI 172

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            L    +H       L+D Q +  HL   GA E+    +  LLE
Sbjct: 173 ALWKFCEHFVSSNGKLIDCQMMNPHLESLGAQEMKRSDFKTLLE 216


>gi|170692245|ref|ZP_02883408.1| Leucyltransferase [Burkholderia graminis C4D1M]
 gi|170142675|gb|EDT10840.1| Leucyltransferase [Burkholderia graminis C4D1M]
          Length = 245

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 103/179 (57%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGII-PLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+ P E   +P   K LK+ +R + ++IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLKRVLRDDAWEIRVDHDFAAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   +  AY  L  MG AH+IE W +   VGGLYGVS G +FFGESMF+ + 
Sbjct: 112 RRGQRGTWITADVVDAYTSLHRMGDAHSIETWFEGERVGGLYGVSFGKMFFGESMFADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASK+ L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  ++  P I +
Sbjct: 172 DASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVDAPRIPW 230


>gi|238753484|ref|ZP_04614847.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia ruckeri
           ATCC 29473]
 gi|238708437|gb|EEQ00792.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia ruckeri
           ATCC 29473]
          Length = 236

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           S+ I W  P  R ++     H  + ++++ RR  Y   +N AF  V++ACA +      T
Sbjct: 53  SEMILWWSPDPRAVLYPAELHISRSMRRFHRRCPYRFTLNQAFADVVAACADRPDD--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +Q+AY  L  MG+AH++E W+ D LVGGLYG+++GA+F GESMFS  ENASK  L
Sbjct: 111 WIGHEVQQAYCQLHGMGHAHSLEVWQDDELVGGLYGIAMGALFCGESMFSRAENASKSGL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
                H       L+D Q +  H    GA EI    + + L  
Sbjct: 171 MAFCHHFTHHGGELIDCQVLNAHTASLGAREIPRSHFLQHLSQ 213


>gi|78066168|ref|YP_368937.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia sp.
           383]
 gi|119367690|sp|Q39GX3|LFTR_BURS3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|77966913|gb|ABB08293.1| Leucyltransferase [Burkholderia sp. 383]
          Length = 254

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 100/179 (55%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGI-IPLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I +P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLREPEWEVRVDHDFPGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGVS G +FFGESM++   
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADAT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL+++   ++D Q  T+HL   G  EI    +   + +A+  P I +
Sbjct: 172 DASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPW 230


>gi|296273709|ref|YP_003656340.1| leucyl/phenylalanyl-tRNA/protein transferase [Arcobacter
           nitrofigilis DSM 7299]
 gi|296097883|gb|ADG93833.1| leucyl/phenylalanyl-tRNA/protein transferase [Arcobacter
           nitrofigilis DSM 7299]
          Length = 225

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 1/161 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P +R ++  E F   K LK+ I+ + + ++ N  FE VI +CA  K +   +TWI
Sbjct: 63  IHWFSPKKRMVLYPEEFRLTKSLKRVIKNKGFVVKSNERFEDVIKSCANIKRKHEDSTWI 122

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +    +AY +LF++ YA +IE +  D LVGGLYG+ +G VF GESMFS  ++ASK+   H
Sbjct: 123 SHEFIQAYTNLFHLEYAFSIECYLDDKLVGGLYGLLIGDVFCGESMFSLEKDASKVAFYH 182

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           L K  K+    ++D Q    HL   GA EI   +Y K+L+N
Sbjct: 183 LCKQAKQNGIKIIDCQVYNEHLASLGAKEIPREEYFKILKN 223


>gi|167582024|ref|ZP_02374898.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           thailandensis TXDOH]
          Length = 240

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 100/181 (55%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IRI+  F  V+ ACAQ
Sbjct: 37  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRIDCDFAGVMRACAQ 94

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++ 
Sbjct: 95  APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGGMFFGESMYAD 154

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           + +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P IS
Sbjct: 155 VSDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIS 214

Query: 178 F 178
           +
Sbjct: 215 W 215


>gi|167719750|ref|ZP_02402986.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei DM98]
          Length = 255

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 170 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|256829857|ref|YP_003158585.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfomicrobium
           baculatum DSM 4028]
 gi|256579033|gb|ACU90169.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfomicrobium
           baculatum DSM 4028]
          Length = 237

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 91/168 (54%), Gaps = 1/168 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP- 64
            +  I W  P  R I+     H PKRL + +R+  +   ++T FE VI+ CA   +    
Sbjct: 49  ENSPILWWSPDPRLILEPARIHVPKRLDRILRQGRFRFTLDTVFEQVITRCAATPRNGAH 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +G+AH+IE W    L GGLYGV+LG  FFGESMF    +ASK 
Sbjct: 109 GTWIVPEMLAAYCRLHELGFAHSIEVWSGANLAGGLYGVALGGAFFGESMFYLEPDASKA 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            L  L++ L+   F+L D Q  T H+ +FG  E+   ++   LE ALK
Sbjct: 169 GLVTLMRALESAGFVLFDCQQTTAHMLRFGGFEVPRGEFLSRLEGALK 216


>gi|227538623|ref|ZP_03968672.1| Leucyltransferase [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241542|gb|EEI91557.1| Leucyltransferase [Sphingobacterium spiritivorum ATCC 33300]
          Length = 210

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 92/164 (56%), Gaps = 4/164 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           ++   I W  P  R +I  E     K +K+ +R+  + + +NTAFE VI  CA+  +K +
Sbjct: 48  SDDSPILWYAPHERFVIFPERLKVSKSMKQVLRKAEFKVTLNTAFEQVIRQCAKIERKDQ 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +  AYI L   GYAH IE W++D LVGGLYGV +G VF GESMFS + NASK
Sbjct: 108 DGTWITADMIDAYIGLHKSGYAHAIEVWQEDQLVGGLYGVLIGQVFCGESMFSKVPNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             L HL +    +    +D QF T+HL   G   I+   Y  +L
Sbjct: 168 TALIHLFQFFDLK---FVDCQFHTDHLASMGGEMISQEDYLNIL 208


>gi|254429250|ref|ZP_05042957.1| leucyl/phenylalanyl-tRNA--protein transferase [Alcanivorax sp.
           DG881]
 gi|196195419|gb|EDX90378.1| leucyl/phenylalanyl-tRNA--protein transferase [Alcanivorax sp.
           DG881]
          Length = 245

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 90/166 (54%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           +A++Q I W  P  R +I L+  H  + L +++R+  + + ++  FE+V+  CA   Q  
Sbjct: 49  NADTQPILWWSPAPRCVIWLDQLHVSRSLARHLRQADFSVTLDRDFETVMRTCAAPRQGE 108

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           P TWI+  + +AY  L  +GYAH++E W+   L GGLYG+ LG +FFGESM S   N SK
Sbjct: 109 PGTWISEEVVEAYCHLHQLGYAHSVEIWQNGELAGGLYGIQLGQLFFGESMASPQRNGSK 168

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           + L  L    +     LLD Q    HL   GA  I    +   LE+
Sbjct: 169 VALVALRNLSRVLDIRLLDAQIENPHLMSMGAQMIDRDAFETCLED 214


>gi|209515709|ref|ZP_03264573.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           H160]
 gi|209503945|gb|EEA03937.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           H160]
          Length = 245

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 105/179 (58%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGII-PLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+ P E   +P   K LK+ +R ++++IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKLSPSLRKTLKRVLRDDVWEIRVDHDFAAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   + +AY  L  MG AH+IE W +   VGGLYGVSLG +FFGESM++ + 
Sbjct: 112 RRGQHGTWITADVVEAYSSLHRMGDAHSIETWYEGRRVGGLYGVSLGRMFFGESMYTDVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           + SK+ L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  ++  P I +
Sbjct: 172 DGSKMALAALVGHLRRHEVEMIDCQQNTSHLASLGGREIARKTFVAHVRASVGAPAIPW 230


>gi|187479224|ref|YP_787249.1| leucyl/phenylalanyl-tRNA--protein transferase [Bordetella avium
           197N]
 gi|119367689|sp|Q2KW47|LFTR_BORA1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|115423811|emb|CAJ50362.1| leucyl/phenylalanyl-tRNA--protein transferase [Bordetella avium
           197N]
          Length = 250

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 93/179 (51%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR---------ELYDIRINTAFESVISA 55
           +  + + W  P  R ++    F     L+K +RR             +R++TAF  V++A
Sbjct: 50  SEGEPLLWWSPDPRMVLACADFAPSHSLRKTLRRLARAEQAGDTRIQVRVDTAFARVMAA 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA +   +  TWI   +Q AY      G AH+IE W  D LVGGLYG+SLG +FFGESMF
Sbjct: 110 CAGRRDGQAGTWITPEVQAAYCAWHEQGQAHSIETWIDDHLVGGLYGISLGGMFFGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           +H  +ASKI L +LV  L + +   +D Q  T HL   GA  +   Q+ + +   L  P
Sbjct: 170 AHATDASKIALAYLVAFLTRHEVDWIDCQQQTRHLASLGARPLPRAQFLQHVARVLAKP 228


>gi|134095618|ref|YP_001100693.1| leucyl/phenylalanyl-tRNA--protein transferase [Herminiimonas
           arsenicoxydans]
 gi|158513569|sp|A4G7T5|LFTR_HERAR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|133739521|emb|CAL62572.1| Leucyl/phenylalanyl-tRNA--protein transferase (L/F-transferase)
           (Leucyltransferase) (Phenyalanyltransferase)
           [Herminiimonas arsenicoxydans]
          Length = 243

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 97/180 (53%), Gaps = 8/180 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR--------ELYDIRINTAFESVISAC 56
           +  Q I W     R ++ ++ F     LKK +++          + IR + AFE V+ AC
Sbjct: 52  SEGQPILWWSTDPRMVLFIQDFKISASLKKTLKKIDRSMIANGRWQIRFDHAFEDVMRAC 111

Query: 57  AQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFS 116
           A        TWI+  I   Y  L  +GYAH+ E W  D LVGGLYGVS+G +F+GESMF+
Sbjct: 112 AAPRNGEAGTWISDDIIAGYTRLHRLGYAHSSELWLDDELVGGLYGVSIGNMFYGESMFT 171

Query: 117 HMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
            + +ASKI L +LV+ L      ++D Q  T HL   GA+ I+  ++  LL  A+  P+I
Sbjct: 172 RVTDASKIALAYLVRFLGSHGVSMIDCQQQTAHLASLGAMPISRTEFISLLRQAIAAPQI 231


>gi|206890633|ref|YP_002249323.1| leucyl/phenylalanyl-tRNA--protein transferase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226737726|sp|B5YGC5|LFTR_THEYD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|206742571|gb|ACI21628.1| leucyl/phenylalanyl-tRNA--protein transferase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 244

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 99/168 (58%), Gaps = 1/168 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           N + I W  P +R +I    F   + L + +++++Y +  +  F +VI  CA   +K  T
Sbjct: 48  NHKPILWWSPSKRPLIFPRLFKMSRSLYQTLKKDIYRVSFDKDFVTVIKGCATAPRKDST 107

Query: 66  -TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH++E W  D +VGGLYG+S+G  FFGESMF+ M++ASK+
Sbjct: 108 GTWITEEMIEAYTLLHKLGFAHSVEVWFNDKIVGGLYGISIGRAFFGESMFTLMKDASKV 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            ++ LV+HL    F  +D Q    HL + GA EI    +  LL+ A++
Sbjct: 168 AISCLVEHLILNNFYFIDCQITNKHLIRLGAYEIPRSVFLILLKEAVQ 215


>gi|126440243|ref|YP_001058848.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 668]
 gi|134282349|ref|ZP_01769054.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 305]
 gi|167894454|ref|ZP_02481856.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 7894]
 gi|167902855|ref|ZP_02490060.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei NCTC 13177]
 gi|217423390|ref|ZP_03454891.1| leucyltransferase [Burkholderia pseudomallei 576]
 gi|226196325|ref|ZP_03791907.1| leucyltransferase [Burkholderia pseudomallei Pakistan 9]
 gi|237812106|ref|YP_002896557.1| leucyltransferase [Burkholderia pseudomallei MSHR346]
 gi|166224659|sp|A3N927|LFTR_BURP6 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|126219736|gb|ABN83242.1| leucyltransferase [Burkholderia pseudomallei 668]
 gi|134246387|gb|EBA46476.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 305]
 gi|217393248|gb|EEC33269.1| leucyltransferase [Burkholderia pseudomallei 576]
 gi|225931542|gb|EEH27547.1| leucyltransferase [Burkholderia pseudomallei Pakistan 9]
 gi|237505100|gb|ACQ97418.1| leucyltransferase [Burkholderia pseudomallei MSHR346]
          Length = 255

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 170 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|91783314|ref|YP_558520.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           xenovorans LB400]
 gi|118572932|sp|Q13ZM1|LFTR_BURXL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91687268|gb|ABE30468.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           xenovorans LB400]
          Length = 245

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 102/180 (56%), Gaps = 5/180 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F     L+K +RR L D    IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLRRVLRDDAWEIRVDHDFAAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   + +AY  L  +G AH+IE W +   VGGLYGVS G +FFGESMF+ + 
Sbjct: 112 RRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGRRVGGLYGVSFGKMFFGESMFAEVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
           +ASK+ L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  +++ P I +L
Sbjct: 172 DASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVEAPPIPWL 231


>gi|86146454|ref|ZP_01064777.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio sp. MED222]
 gi|85835717|gb|EAQ53852.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio sp. MED222]
          Length = 236

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 87/157 (55%), Gaps = 1/157 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K LKK+ R+  Y + IN A + VI  C+    K   T
Sbjct: 55  GEPILWWSPAPRAVFNPKTFEPSKSLKKFQRKHNYRVSINQATDKVIGYCSSLRPKE-ET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q AY  L  +G+ H++E W+ D L+GGLYG+  G VF GESMFS   NASKI L
Sbjct: 114 WLNSDMQSAYRKLASLGFCHSVEVWQDDELIGGLYGLQRGQVFCGESMFSLKTNASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            +  +H  +    L+D Q +  HL   GAIE+   ++
Sbjct: 174 WYFCEHFTQFGGQLIDCQVMNPHLESLGAIEVDRDEF 210


>gi|53719477|ref|YP_108463.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei K96243]
 gi|126451822|ref|YP_001066094.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 1106a]
 gi|167738745|ref|ZP_02411519.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 14]
 gi|167815969|ref|ZP_02447649.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 91]
 gi|167845884|ref|ZP_02471392.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei B7210]
 gi|167911098|ref|ZP_02498189.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 112]
 gi|242317915|ref|ZP_04816931.1| leucyltransferase [Burkholderia pseudomallei 1106b]
 gi|254179928|ref|ZP_04886527.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 1655]
 gi|254188667|ref|ZP_04895178.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254198381|ref|ZP_04904803.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei S13]
 gi|254258640|ref|ZP_04949694.1| leucyltransferase [Burkholderia pseudomallei 1710a]
 gi|254297760|ref|ZP_04965213.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 406e]
 gi|81607892|sp|Q63TV3|LFTR_BURPS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|158513527|sp|A3NUS3|LFTR_BURP0 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|52209891|emb|CAH35863.1| putative leucyl/phenylalanyl-tRNA--protein transferase
           [Burkholderia pseudomallei K96243]
 gi|126225464|gb|ABN89004.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 1106a]
 gi|157807701|gb|EDO84871.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 406e]
 gi|157936346|gb|EDO92016.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|169655122|gb|EDS87815.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei S13]
 gi|184210468|gb|EDU07511.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 1655]
 gi|242141154|gb|EES27556.1| leucyltransferase [Burkholderia pseudomallei 1106b]
 gi|254217329|gb|EET06713.1| leucyltransferase [Burkholderia pseudomallei 1710a]
          Length = 255

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 170 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|167919118|ref|ZP_02506209.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei BCC215]
          Length = 255

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 170 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|170732882|ref|YP_001764829.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           cenocepacia MC0-3]
 gi|254245532|ref|ZP_04938853.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           cenocepacia PC184]
 gi|226736113|sp|B1K0S6|LFTR_BURCC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|124870308|gb|EAY62024.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           cenocepacia PC184]
 gi|169816124|gb|ACA90707.1| Leucyltransferase [Burkholderia cenocepacia MC0-3]
          Length = 254

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 101/179 (56%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGI-IPLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I +P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLRAPEWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGVS G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  L+ HL+++   ++D Q  T+HL   G  EI    +   + +A+  P I +
Sbjct: 172 DASKIALAALIAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPW 230


>gi|323499491|ref|ZP_08104462.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sinaloensis
           DSM 21326]
 gi|323315478|gb|EGA68518.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sinaloensis
           DSM 21326]
          Length = 221

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (55%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K LKKY R+  Y + IN A   VI  CA   +    T
Sbjct: 34  GEPILWWSPSPRAVFNPKTFKAAKSLKKYQRKHAYTVSINRATADVIDHCA-SLRSPEET 92

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  ++ AY  L   G+ H++E W ++ LVGGLYG+S+G +F GESMFS   NASK+ L
Sbjct: 93  WLNEDMRTAYKTLAQQGFCHSVEVWHEEQLVGGLYGISVGQLFCGESMFSLKTNASKVAL 152

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +   H K+ +  L+D Q +  HL   GA E+   +++K L
Sbjct: 153 WYFCHHFKQFEGQLIDCQVMNPHLASLGATELERDEFSKTL 193


>gi|53804143|ref|YP_114230.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylococcus
           capsulatus str. Bath]
 gi|61213338|sp|Q607G8|LFTR_METCA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|53757904|gb|AAU92195.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylococcus
           capsulatus str. Bath]
          Length = 235

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 96/184 (52%), Gaps = 9/184 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
                I W  P  R ++  E     + L+K +RR L+    + AF +VI+ACA++ +K  
Sbjct: 52  GEGDPILWWSPDPRLVLFPEKLRISRSLRKTLRRRLFRFSFDRAFRAVITACAERREKSE 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TW+   +Q AY+   + G+AH+ EAW+   LVGGLYGV++G +F+GESMF  + +ASK 
Sbjct: 112 GTWLTADMQSAYLAFHHAGFAHSFEAWQDGALVGGLYGVAMGRIFYGESMFHRVTDASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE---------NALKHPE 175
            L   V  L    + ++D Q  ++HL   GA  I   ++  L+           A KH  
Sbjct: 172 ALAFAVGCLSHWGYRMIDCQVYSSHLVSLGASTIPRSEFQALVSEYSETSVDPEAWKHAP 231

Query: 176 ISFL 179
             FL
Sbjct: 232 GDFL 235


>gi|283850417|ref|ZP_06367706.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio sp.
           FW1012B]
 gi|283574443|gb|EFC22414.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio sp.
           FW1012B]
          Length = 228

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 1/162 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWI 68
           I W  P  R I+     H  KRL + IR   + + ++T F  VI  CA  ++     TWI
Sbjct: 53  ILWWSPDPRPILFPGLVHVSKRLARTIRSGRFAVTLDTDFAGVIRGCAGTSRTAGDGTWI 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              + +AY  L   GYAH++EAW+   LVGG YGV++G  FFGESMF  + +ASK+    
Sbjct: 113 VPEMMEAYERLHQAGYAHSVEAWQDGELVGGAYGVAIGKAFFGESMFHRVTDASKVAFVT 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           L +HL  + F  LD Q  T HL +FGA+E+   ++ K L+ A
Sbjct: 173 LCRHLAGQGFHFLDCQQTTGHLCRFGAVEVRRGEFLKRLDLA 214


>gi|90406981|ref|ZP_01215171.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychromonas sp.
           CNPT3]
 gi|90311852|gb|EAS39947.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychromonas sp.
           CNPT3]
          Length = 239

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 91/170 (53%), Gaps = 4/170 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + + W  P  R  I     H  K +++ IR+E Y + IN  F  VI ACA   + +P T
Sbjct: 55  GEPLLWWSPNERATILAGKVHISKSMRRLIRKENYTLSINKHFSEVIHACAAPRKGQPGT 114

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +  AY+ L   G+AH++E ++ + LVGGLYG+ LG +F GESMFS  ENASK+  
Sbjct: 115 WITAEMIDAYLQLHQQGWAHSVEVFRGNELVGGLYGIGLGQIFCGESMFSRSENASKMAF 174

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL----ENALK 172
             L +H       L+D Q +T HL   G    +   + K L    +NALK
Sbjct: 175 IALHQHFHAANGKLIDCQMLTPHLASLGVQASSRADFIKQLKLYQKNALK 224


>gi|293603673|ref|ZP_06686093.1| leucyltransferase [Achromobacter piechaudii ATCC 43553]
 gi|292817941|gb|EFF77002.1| leucyltransferase [Achromobacter piechaudii ATCC 43553]
          Length = 252

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 93/181 (51%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR---------ELYDIRINTAFESVISA 55
           +  + + W  P  R ++ ++ F     L+K +R+             +R++T F  V+  
Sbjct: 50  SEGEPVLWWSPDPRMVLAIKDFSPSHSLRKLLRQIASQEQDEQPRVQVRVDTVFSRVMGQ 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA     +P TWI   +Q+AY +    GY H+IE W    L GGLYG+SLG +FFGESMF
Sbjct: 110 CAAPRDGQPGTWITGAMQQAYAEWHRAGYVHSIETWIDGELAGGLYGISLGRMFFGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           + + NASKI L +LV++L       +D Q  T HL   GA  I   Q+ + +  A   P 
Sbjct: 170 TRVPNASKIALAYLVRYLAANGVQRIDCQQQTQHLASLGARPIPRGQFLQHVRQATAQPP 229

Query: 176 I 176
           +
Sbjct: 230 V 230


>gi|119510128|ref|ZP_01629267.1| leucyl/phenylalanyl-tRNA--protein transferase [Nodularia spumigena
           CCY9414]
 gi|119465189|gb|EAW46087.1| leucyl/phenylalanyl-tRNA--protein transferase [Nodularia spumigena
           CCY9414]
          Length = 195

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 104/174 (59%), Gaps = 7/174 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  ++  + W     R +IPL E FH PK L++ + +E + + IN  F+ V++ CA  
Sbjct: 19  MAD--DNTGLGWYGSRDRTLIPLDERFHYPKSLQRVLNQERFTVAINRDFQGVVAGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  +Q+ Y  L+  GYA++ E W+ D L GG+ G+ +G  F GESMF H+ 
Sbjct: 75  --NRETTWISRELQEIYWLLYQNGYAYSFETWQGDELAGGILGIVIGGAFIGESMFYHIT 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             SK+ +  LV+ L++RQF+L D Q +  HL +FGA  I   +Y  LL+ AL+ 
Sbjct: 133 EGSKVAMVKLVERLRQRQFVLFDAQMMNPHLERFGAYGIRDEEYQALLKEALQR 186


>gi|167623655|ref|YP_001673949.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           halifaxensis HAW-EB4]
 gi|189046561|sp|B0TQ11|LFTR_SHEHH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|167353677|gb|ABZ76290.1| Leucyltransferase [Shewanella halifaxensis HAW-EB4]
          Length = 236

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 95/168 (56%), Gaps = 1/168 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +         + L KY++++ +   IN  FE+V + CA+    +  TWI+
Sbjct: 57  ILWWSPDPRAVFVPGNMKISRSLVKYLKKQDWTYTINHNFEAVTAGCAEPRAGQDGTWIS 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             IQ+AY+ L   GYAH++E W+   L+GGLYG+++G VF GESMF    NASK  +  L
Sbjct: 117 SEIQQAYLSLHQQGYAHSLEVWQDKQLIGGLYGLAIGQVFCGESMFHRATNASKAAMIVL 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
            +HL++  F L+D Q +  HL   GA  I    + +LL + L+  E+S
Sbjct: 177 QQHLQRCGFKLIDAQVVNPHLDSLGAKSIKRDDFLRLLTH-LRDGEVS 223


>gi|121998179|ref|YP_001002966.1| leucyl/phenylalanyl-tRNA--protein transferase [Halorhodospira
           halophila SL1]
 gi|158514016|sp|A1WWV2|LFTR_HALHL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|121589584|gb|ABM62164.1| Leucyltransferase [Halorhodospira halophila SL1]
          Length = 247

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 90/170 (52%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
              Q I W  P  RG+     F   + L++ + +    + ++T FE+V++ CA     + 
Sbjct: 54  GEGQPILWWSPDPRGVFLPGDFRISRSLRRRLNQTRMQVTLDTEFEAVVAGCAAPRPDQD 113

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY +L   G AH+ E W    LVGG+YGV+L   FFGESMFS ME+ASK+
Sbjct: 114 GTWITREMIAAYTELHLQGCAHSAEVWLDGELVGGVYGVALNGAFFGESMFSRMEDASKV 173

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            LT L   L +  F L D Q    HL + G  EI   +Y + LE AL+ P
Sbjct: 174 GLTWLTAQLWRWGFALFDCQMSNPHLARLGVREIPRSEYLRRLEPALRAP 223


>gi|206579515|ref|YP_002239463.1| leucyl/phenylalanyl-tRNA--protein transferase [Klebsiella
           pneumoniae 342]
 gi|288936312|ref|YP_003440371.1| leucyl/phenylalanyl-tRNA/protein transferase [Klebsiella variicola
           At-22]
 gi|290510632|ref|ZP_06550002.1| leucyl/phenylalanyl-tRNA-protein transferase [Klebsiella sp.
           1_1_55]
 gi|226737700|sp|B5XYA8|LFTR_KLEP3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|206568573|gb|ACI10349.1| leucyl/phenylalanyl-tRNA--protein transferase [Klebsiella
           pneumoniae 342]
 gi|288891021|gb|ADC59339.1| leucyl/phenylalanyl-tRNA/protein transferase [Klebsiella variicola
           At-22]
 gi|289777348|gb|EFD85346.1| leucyl/phenylalanyl-tRNA-protein transferase [Klebsiella sp.
           1_1_55]
          Length = 234

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 90/158 (56%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++ +R  Y + +N AF  VI  CA  + +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEQFHLSRSMKRFHQRSPYRVTLNHAFGEVIEGCA--SDRDEGTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +I +AY  L  +G+AH+IE W+++ LVGG+YGV+ GA+F GESMFS  ENASK  L   
Sbjct: 114 SSIVRAYHQLHELGHAHSIEVWQENTLVGGMYGVAQGALFCGESMFSRAENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +   +    L+D Q + NH    GA++I    Y   L
Sbjct: 174 CQAFTQSGGKLIDCQVLNNHTASLGAVDIPRRDYLDYL 211


>gi|221213033|ref|ZP_03586009.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans CGD1]
 gi|221167246|gb|EED99716.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans CGD1]
          Length = 254

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+  + F     LKK ++R L D    +R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPDEFKVSPSLKKTLKRVLRDPAWEVRVDHDFRGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGV+ G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVAFGQMFFGESMYADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL++    ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALAALVAHLREHGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|221197840|ref|ZP_03570886.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans CGD2M]
 gi|221204602|ref|ZP_03577619.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans CGD2]
 gi|221175459|gb|EEE07889.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans CGD2]
 gi|221181772|gb|EEE14173.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans CGD2M]
          Length = 254

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+  + F     LKK ++R L D    +R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPDEFKVSPSLKKTLKRVLRDPAWEVRVDHDFRGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGV+ G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVAFGQMFFGESMYADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL++    ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALAALVAHLREHGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|218779931|ref|YP_002431249.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfatibacillum
           alkenivorans AK-01]
 gi|226736123|sp|B8FGA1|LFTR_DESAA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|218761315|gb|ACL03781.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfatibacillum
           alkenivorans AK-01]
          Length = 233

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 94/173 (54%), Gaps = 1/173 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR- 63
           +  + I W  P  R I+    FH    LKK +R++ + + ++TAF+ V++ACA   Q   
Sbjct: 48  SEGEPILWWSPNPRLILIPSRFHMSSSLKKTLRQKRFAVTLDTAFKDVMAACAAVRQDHG 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   ++KAY  L   G+AH++EAW+   L GGLYGVSLG  FFGESMF    NASK
Sbjct: 108 EGTWIVPEMEKAYRRLHQAGFAHSVEAWQDGELAGGLYGVSLGRGFFGESMFFKRSNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
                LV+ L   +F  +D Q  T HL   GA E     +  +L   L+ P +
Sbjct: 168 AAFAVLVEFLTAHEFEFIDCQMKTPHLMSLGAEERPRSVFLDMLHQTLEFPTL 220


>gi|253990324|ref|YP_003041680.1| leucyl/phenylalanyl-tRNA --protein transferase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781774|emb|CAQ84937.1| leucyl/phenylalanyl-tRNA--protein transferase [Photorhabdus
           asymbiotica]
          Length = 233

 Score =  124 bits (310), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 89/161 (55%), Gaps = 6/161 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R +I     H  + L++++R   Y I +N AFE VI +CAQ+ +    TWI   
Sbjct: 57  WWSPDPRAVIIPGELHIGRTLRRFLRNHPYRITVNHAFEQVIYSCAQRQEG---TWIGGD 113

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +++ Y +L   G AH++E W  + LVGGLYGVS+G +F GESMFS MENASK  L     
Sbjct: 114 VKQGYQELHQTGRAHSVEVWHGEKLVGGLYGVSVGKLFCGESMFSRMENASKCALIAFYH 173

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEI---THVQYAKLLEN 169
           H  +    L+D Q + +H    GA EI   T +QY     N
Sbjct: 174 HFLRHDGELIDCQVLNHHTASLGAKEIPRETFIQYLYQFRN 214


>gi|257093512|ref|YP_003167153.1| leucyl/phenylalanyl-tRNA/protein transferase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046036|gb|ACV35224.1| leucyl/phenylalanyl-tRNA/protein transferase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 235

 Score =  124 bits (310), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 96/164 (58%), Gaps = 1/164 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KR 63
           ++ + I W  P  R ++    F   + L++ +R   ++ R+++ F +VI ACA+  +  +
Sbjct: 49  SSGEPILWWSPDPRMVLFPGEFRISRSLRRCLRSGRFEARLDSDFRAVIRACAETPRFGQ 108

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q AY  LF +G+AH++E W    LVGGLYG+++G +F+GESMFS + NASK
Sbjct: 109 QGTWITRDMQHAYWQLFELGFAHSVETWLDGKLVGGLYGLAIGRMFYGESMFSLVSNASK 168

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           +   HL + L++  F ++D Q  T HL   GA EI    +   L
Sbjct: 169 VAAAHLARFLEEEGFGMIDCQMNTPHLASLGAREIPRAVFMDRL 212


>gi|53723461|ref|YP_102922.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           ATCC 23344]
 gi|124384200|ref|YP_001026391.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           NCTC 10229]
 gi|52426884|gb|AAU47477.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           ATCC 23344]
 gi|124292220|gb|ABN01489.1| leucyltransferase [Burkholderia mallei NCTC 10229]
          Length = 298

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 95  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDYDFAGVMRACAQ 152

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 153 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 212

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 213 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 272

Query: 178 F 178
           +
Sbjct: 273 W 273


>gi|167836757|ref|ZP_02463640.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           thailandensis MSMB43]
          Length = 255

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 100/181 (55%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRVSATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IEAW     VGGLYGVS G +FFGESM++ 
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIEAWLDGRRVGGLYGVSFGRMFFGESMYAD 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           + +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 170 VSDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|323494220|ref|ZP_08099333.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio brasiliensis
           LMG 20546]
 gi|323311534|gb|EGA64685.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio brasiliensis
           LMG 20546]
          Length = 236

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 91/161 (56%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K LKK+ R++ Y + I+ A E VI  CA  T+    T
Sbjct: 55  GEPILWWSPSPRAVFTPKTFQPAKSLKKFQRKQQYRVSIDHATERVIDFCA-STRHEDET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  ++ AY  L   G+ H++E W  D LVGGLYG+S+G +F GESMFS   NASKI L
Sbjct: 114 WLNEDMRAAYKQLARAGHCHSVEVWHDDELVGGLYGLSIGKLFCGESMFSLKANASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  +H ++    L+D Q +  HL   GA+E+    + + L
Sbjct: 174 WYFCEHFQRHGGELIDCQVMNPHLASLGAVELHREDFMQRL 214


>gi|238749790|ref|ZP_04611295.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia rohdei ATCC
           43380]
 gi|238712445|gb|EEQ04658.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia rohdei ATCC
           43380]
          Length = 236

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 87/149 (58%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++RR  Y   +N AFE VI ACA  +Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLFPEDLHISRSMRRFLRRCPYRFTLNHAFEDVIRACA--SQRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH+IE W ++ LVGG+YG+++G +F GESMFS  +NASK  L   
Sbjct: 114 EEVQQAYCQLHALGHAHSIEVWLENELVGGVYGIAVGKLFCGESMFSRADNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H       L+D Q +  H    GAIEI
Sbjct: 174 CHHFTLHGGELIDCQVLNAHTASLGAIEI 202


>gi|323190706|gb|EFZ75975.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           RN587/1]
          Length = 234

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++DVLVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRCVVEAYHRLHELGHAHSIEVWREDVLVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|258405488|ref|YP_003198230.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfohalobium
           retbaense DSM 5692]
 gi|257797715|gb|ACV68652.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfohalobium
           retbaense DSM 5692]
          Length = 249

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 97/165 (58%), Gaps = 5/165 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---TWI 68
           W  P  R ++  + FH P+ L++ + +  + + ++ +FE +I  CA+   KRP    TW+
Sbjct: 55  WWSPDPRLVLFCDEFHMPRSLRRTLNKGEFRLSVDQSFEQIIQGCARA--KRPEGEGTWL 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AY +L   G+AH +  W+ + LVGG+YGV+LG +F+GESMF  + NASK  L  
Sbjct: 113 TPEMIDAYSELHRQGHAHCVATWQGEELVGGIYGVALGRIFYGESMFYSVPNASKAALVA 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           LV+ L++R F  +D Q  T H+ +FGA EI   Q   L++  L+ 
Sbjct: 173 LVQVLRERGFTAMDCQQTTAHMLRFGAREIPRGQLLHLVQKGLEE 217


>gi|218709071|ref|YP_002416692.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio splendidus
           LGP32]
 gi|254809172|sp|B7VM36|LFTR_VIBSL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|218322090|emb|CAV18181.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio splendidus
           LGP32]
          Length = 236

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 88/157 (56%), Gaps = 1/157 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K LKK+ R+  Y + IN A + VI  C+   +    T
Sbjct: 55  GEPILWWSPAPRAVFNPKTFEPSKSLKKFQRKHNYRVSINQATDRVIGYCS-SLRPEEET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q AY +L  +G+ H++E W+ D L+GGLYG+  G VF GESMFS   NASKI L
Sbjct: 114 WLNNDMQAAYRELASLGFCHSVEVWQGDELIGGLYGLQRGQVFCGESMFSLKTNASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            +  +H  +    L+D Q +  HL   GAIE+   ++
Sbjct: 174 WYFCEHFTQFGGQLIDCQVMNPHLESLGAIEVDRDEF 210


>gi|117926539|ref|YP_867156.1| leucyl/phenylalanyl-tRNA--protein transferase [Magnetococcus sp.
           MC-1]
 gi|158512337|sp|A0LCQ7|LFTR_MAGSM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|117610295|gb|ABK45750.1| Leucyltransferase [Magnetococcus sp. MC-1]
          Length = 235

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 6/155 (3%)

Query: 25  TFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGY 84
             H P+ LKK IR+  + I  +  FE V+  C    +    TWI   +++AY+ L  MG+
Sbjct: 69  ALHVPRSLKKAIRQGAFRITFDHVFEQVMHQCG-AVRAAEGTWITPEMEQAYLRLHQMGF 127

Query: 85  AHTIEAWKKD-----VLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFL 139
           AH+ E+W  D      L GG+YGV++G  FFGESMF    NASK+ L  LV HL ++ + 
Sbjct: 128 AHSCESWLMDENHRYQLAGGIYGVAIGGAFFGESMFYRQPNASKVALVALVGHLAQQGYS 187

Query: 140 LLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           L+D Q  T H+ +FGA+E+    + + L+ A+  P
Sbjct: 188 LMDCQMTTQHMLRFGAVEMPRSVFLEDLQQAIAQP 222


>gi|270261168|ref|ZP_06189441.1| leucyl/phenylalanyl-tRNA--protein transferase [Serratia odorifera
           4Rx13]
 gi|270044652|gb|EFA17743.1| leucyl/phenylalanyl-tRNA--protein transferase [Serratia odorifera
           4Rx13]
          Length = 241

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 92/168 (54%), Gaps = 2/168 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++    +H  + LK+++    + I +N  F +VI+ACA +  +   T
Sbjct: 53  GEPILWWSPDPRAVLFPAQYHISRSLKRFLSGNPFRITLNHDFAAVIAACAVRPHE--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +Q+AY+ L  +G+AH++E W+   LVGG+YGV+ GA+F GESMFS   NASK  L
Sbjct: 111 WIGPEVQRAYLHLHRLGFAHSVEVWQDKELVGGMYGVAQGALFCGESMFSRTTNASKCAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               +H       L+D Q +  H    GA EI   Q+ + L N  + P
Sbjct: 171 LAFCRHFAAYGGELIDCQVLNAHTATLGAREIPRRQFLQQLSNLQRKP 218


>gi|308186239|ref|YP_003930370.1| leucyl/phenylalanyl-tRNA-protein transferase [Pantoea vagans C9-1]
 gi|308056749|gb|ADO08921.1| leucyl/phenylalanyl-tRNA-protein transferase [Pantoea vagans C9-1]
          Length = 230

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 92/165 (55%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++  R  Y + +N +F  V+  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLLPEQFHLSRSMKRFHNRSPYRVTMNESFAEVLEGCASGREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +++A++ L+ +G+AH+IE W +  LVGG+YG+++G +F GESMFS  +NASK  L   
Sbjct: 114 FEMKRAWLRLYELGHAHSIEVWDEHQLVGGMYGLAMGQIFCGESMFSRQQNASKTALWVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +H  + Q  L+D Q +  H    GA EI    Y + ++     P
Sbjct: 174 CQHFIRHQGRLVDCQVLNPHTASLGAQEIPRADYLQYVQRLADQP 218


>gi|311104234|ref|YP_003977087.1| leucyl/phenylalanyl-tRNA--protein transferase [Achromobacter
           xylosoxidans A8]
 gi|310758923|gb|ADP14372.1| leucyl/phenylalanyl-tRNA--protein transferase [Achromobacter
           xylosoxidans A8]
          Length = 257

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 96/183 (52%), Gaps = 9/183 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR---------ELYDIRINTAFESVISA 55
           +  + I W  P  R ++ ++ F     L+K +R+             +R++TAF  V++ 
Sbjct: 50  SEGEPILWWSPDPRMVLSIKDFAPSHSLRKLLRQVASQEHAAAPRVQVRVDTAFAEVMAQ 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA     +P TWI   +Q+AY      GY H+IE W    L GGLYG+SLG +FFGESMF
Sbjct: 110 CAAPRDGQPGTWITAAMQQAYRAWHEAGYVHSIETWIDGELAGGLYGISLGRMFFGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           +   NASKI L++LV++L  +    +D Q  T HL   GA  I    + + +  A   P 
Sbjct: 170 TRAPNASKIALSYLVRYLAAQGVERIDCQQQTRHLASLGARPIPRAAFLQHVRAATALPA 229

Query: 176 ISF 178
           I++
Sbjct: 230 IAW 232


>gi|262375701|ref|ZP_06068933.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter lwoffii
           SH145]
 gi|262309304|gb|EEY90435.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter lwoffii
           SH145]
          Length = 243

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 94/174 (54%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R II  E +H  K L + ++++ Y I +N AFE VI +C+       
Sbjct: 49  SEGDPICWWSPEPRCIIRPEDYHPSKSLLRNMKKQDYKITVNHAFERVIRSCSLPRAYAN 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  I   Y D+F  GY ++IE W +D +VGGLYGV++G   FGESMFS   + SK+
Sbjct: 109 DTWISEDIIAGYCDMFDAGYGYSIEVWDEDRVVGGLYGVTIGQGCFGESMFSTQTDVSKM 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
               L+   ++ +   +D Q + +HL   GA  ++   Y   L++ +K P I +
Sbjct: 169 AFYTLMLIGQENKLPWIDCQLVNDHLLSLGACTLSRQAYLNSLQDIVKKPAIDW 222


>gi|238913430|ref|ZP_04657267.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 234

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + NH    GAIEI    Y   L +  + P
Sbjct: 174 CDEFIRHGGKLIDCQVLNNHTASLGAIEIPRRDYLDHLASLRQQP 218


>gi|152969474|ref|YP_001334583.1| leucyl/phenylalanyl-tRNA--protein transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238893946|ref|YP_002918680.1| leucyl/phenylalanyl-tRNA--protein transferase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|166224664|sp|A6T6Y2|LFTR_KLEP7 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|150954323|gb|ABR76353.1| leucyl/phenylalanyl-tRNA--protein transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238546262|dbj|BAH62613.1| leucyl/phenylalanyl-tRNA--protein transferase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 233

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 89/158 (56%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++ +R  Y + +N AF  VI  CA  + +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEQFHLSRSMKRFHQRSPYRVTLNHAFGEVIEGCA--SDRDEGTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +I +AY  L  +G+AH+IE W+++ LVGG+YGV+ GA+F GESMFS  ENASK  L   
Sbjct: 114 SSIVRAYHQLHELGHAHSIEVWQENTLVGGMYGVAQGALFCGESMFSRAENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + NH    GA++I    Y   L
Sbjct: 174 CQDFAHSGGKLIDCQVLNNHTASLGAVDIPRRDYLDYL 211


>gi|325105751|ref|YP_004275405.1| leucyl/phenylalanyl-tRNA/protein transferase [Pedobacter saltans
           DSM 12145]
 gi|324974599|gb|ADY53583.1| leucyl/phenylalanyl-tRNA/protein transferase [Pedobacter saltans
           DSM 12145]
          Length = 209

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 4/165 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           ++   I W  P  R ++  E     K +K+ IR   +++ I+ AF  VI  CA+ T+K +
Sbjct: 47  SDDTPILWYAPHERFVLFPEKLKISKSMKQVIRSGKFEVTIDEAFPEVIKTCAKITRKDQ 106

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +QKAYI LF +G+AH++E W++  LVGGLYGV +  +F GESMFS   N+SK
Sbjct: 107 DGTWITNDMQKAYIKLFRLGFAHSVEVWEEGSLVGGLYGVLINKIFCGESMFSKTSNSSK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           + L  L +++  +   L+D Q  TNHL   GA  I+  +Y K L+
Sbjct: 167 LALIWLAENIDLK---LIDCQVHTNHLESMGAEMISMEEYLKYLK 208


>gi|37525543|ref|NP_928887.1| leucyl/phenylalanyl-tRNA--protein transferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|47115705|sp|Q7N6F5|LFTR_PHOLL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|36784971|emb|CAE13889.1| leucyl, phenylalanyl-tRNA--protein transferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 231

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 86/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R +I     H  + L++++R   Y I +N AFE V+  CAQ+ +    TWI   
Sbjct: 59  WWSPDPRAVIIPGELHIGRTLRRFLRNTPYHITVNHAFEQVVHFCAQRQE---GTWIGKD 115

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           IQ+ Y  L+  G AH++E W  + +VGGLYGVS+G +F GESMFS MENASK        
Sbjct: 116 IQQGYKKLYQTGQAHSVEVWHNERIVGGLYGVSVGTLFCGESMFSRMENASKCAFIAFYH 175

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    LLD Q + +H    GA EI   ++ + L
Sbjct: 176 HFLRHGGELLDCQVLNHHTASLGAKEIPREEFIQYL 211


>gi|167824340|ref|ZP_02455811.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           pseudomallei 9]
          Length = 213

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 10  SDGQPVLWWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 67

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H
Sbjct: 68  APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAH 127

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 128 ASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIP 187

Query: 178 F 178
           +
Sbjct: 188 W 188


>gi|157146428|ref|YP_001453747.1| leucyl/phenylalanyl-tRNA--protein transferase [Citrobacter koseri
           ATCC BAA-895]
 gi|166224662|sp|A8AIJ8|LFTR_CITK8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|157083633|gb|ABV13311.1| hypothetical protein CKO_02187 [Citrobacter koseri ATCC BAA-895]
          Length = 234

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 86/154 (55%), Gaps = 2/154 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R I+  ET H  + +K++ +R  Y + +N AF  VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAILQPETLHISRSMKRFHKRSPYRVTLNYAFGQVIEGCANDRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W+ + LVGG+YGVS G +F GESMFS  ENASK  L   
Sbjct: 114 RDVVEAYHRLHELGHAHSIEVWRHNALVGGMYGVSQGTLFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
                ++   L+D Q + +H    GA+EI   QY
Sbjct: 174 CAEFIRQGGKLIDCQVLNSHTASLGAVEIPRRQY 207


>gi|148977553|ref|ZP_01814132.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrionales bacterium
           SWAT-3]
 gi|145963204|gb|EDK28471.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrionales bacterium
           SWAT-3]
          Length = 236

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 89/162 (54%), Gaps = 1/162 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K LKK+ R+  Y + IN A + VI  C+   +    T
Sbjct: 55  GEPILWWSPAPRAVFNPKTFKPSKSLKKFQRKHNYRVSINQATDRVIGYCS-SLRPEEET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q AY +L  +G+ H++E W+ D LVGGLYG+  G VF GESMFS   NASK+ L
Sbjct: 114 WLNSDMQAAYRELASLGFCHSVEVWQGDELVGGLYGLQRGQVFCGESMFSLKTNASKVAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +   H  +    L+D Q +  HL   GA+E+   ++   L+
Sbjct: 174 WYFCHHFARSGGKLIDCQVMNPHLESLGAMEVEREEFLSSLQ 215


>gi|71906835|ref|YP_284422.1| leucyl/phenylalanyl-tRNA--protein transferase [Dechloromonas
           aromatica RCB]
 gi|119367694|sp|Q47GS9|LFTR_DECAR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|71846456|gb|AAZ45952.1| Leucyl/phenylalanyl-tRNA--protein transferase [Dechloromonas
           aromatica RCB]
          Length = 234

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 93/150 (62%), Gaps = 5/150 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---TWI 68
           W  P  R ++  E F   + LKK +R   +++R ++ F  V++ CA  +  RP    TWI
Sbjct: 56  WYSPNPRMVLFPEEFRLTRSLKKTLRSGKFEVRFDSNFRGVMANCA--STPRPGQDGTWI 113

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +  ++ AY  L  +G+AH++E +++ V+VGGLYG+++G +F+GESMFSH  +ASK+   H
Sbjct: 114 SPEMKHAYTRLHELGWAHSVETYEEGVMVGGLYGLAIGHMFYGESMFSHRTDASKVAFAH 173

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
           LV +L   QF ++D Q  T+HL   G  EI
Sbjct: 174 LVDYLVNNQFGMIDCQMYTDHLASLGGREI 203


>gi|262041013|ref|ZP_06014234.1| leucyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|329998525|ref|ZP_08303135.1| leucyltransferase [Klebsiella sp. MS 92-3]
 gi|259041648|gb|EEW42698.1| leucyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|328538646|gb|EGF64744.1| leucyltransferase [Klebsiella sp. MS 92-3]
          Length = 239

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 89/158 (56%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++ +R  Y + +N AF  VI  CA  + +   TWI 
Sbjct: 62  ILWWSPDPRAVLWPEQFHLSRSMKRFHQRSPYRVTLNHAFGEVIEGCA--SDRDEGTWIT 119

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +I +AY  L  +G+AH+IE W+++ LVGG+YGV+ GA+F GESMFS  ENASK  L   
Sbjct: 120 SSIVRAYHQLHELGHAHSIEVWQENTLVGGMYGVAQGALFCGESMFSRAENASKTALLVF 179

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + NH    GA++I    Y   L
Sbjct: 180 CQDFAHSGGKLIDCQVLNNHTASLGAVDIPRRDYLDYL 217


>gi|320175325|gb|EFW50431.1| Leucyl/phenylalanyl-tRNA--protein transferase [Shigella dysenteriae
           CDC 74-1112]
          Length = 234

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H   FGA EI    Y   L
Sbjct: 169 ALLVFCEEFIGHGGKLIDCQVLNDHTASFGACEIPRRDYLNYL 211


>gi|291616889|ref|YP_003519631.1| Aat [Pantoea ananatis LMG 20103]
 gi|291151919|gb|ADD76503.1| Aat [Pantoea ananatis LMG 20103]
 gi|327393317|dbj|BAK10739.1| leucyl/phenylalanyl-tRNA--protein transferase Aat [Pantoea ananatis
           AJ13355]
          Length = 230

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 94/165 (56%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  + FH  + +K++ ++  Y + +N AF  V+  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLLPDRFHLSRSMKRFHQQSPYRVTMNEAFSDVVEGCAAGREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +++A++ L+ +G+AH+IE W++  LVGG+YG++LG +F GESMFS   NASK  L   
Sbjct: 114 FEVKRAWLKLYELGHAHSIEVWREQDLVGGMYGLALGQIFCGESMFSLQTNASKTALWVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            +H  K +  L+D Q +  H    GA++I    Y   ++N    P
Sbjct: 174 CQHFIKHKGRLVDCQILNPHTASLGAVDIPREAYLDAVKNLSSQP 218


>gi|161524849|ref|YP_001579861.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans ATCC 17616]
 gi|189350401|ref|YP_001946029.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           multivorans ATCC 17616]
 gi|226736115|sp|A9AJ16|LFTR_BURM1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|160342278|gb|ABX15364.1| Leucyltransferase [Burkholderia multivorans ATCC 17616]
 gi|189334423|dbj|BAG43493.1| leucyl/phenylalanyl-tRNA-protein transferase [Burkholderia
           multivorans ATCC 17616]
          Length = 254

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+  + F     LKK ++R L D    +R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPDEFKVSPSLKKTLKRVLRDPAWEVRVDHDFRGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGV+ G +FFGESM++ + 
Sbjct: 112 RRGQRGTWITAEIIDAYSSLYRSGNAHSIETWHDGRRVGGLYGVAFGQMFFGESMYADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL++    ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALAALVAHLREHGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|50084099|ref|YP_045609.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter sp.
           ADP1]
 gi|52783114|sp|Q6FDS1|LFTR_ACIAD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|49530075|emb|CAG67787.1| leucyl, phenylalanyl-tRNA-protein transferase [Acinetobacter sp.
           ADP1]
          Length = 241

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 95/169 (56%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +I  E +   K L + +++  Y I +N AFE VI +CA        TWI+
Sbjct: 52  ICWWSPEPRCVIYPEQYQPSKTLIRSMKKYDYQITMNRAFEKVIRSCALPRNYTNETWIS 111

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I + Y++LF  GYA+++E W+ D L+GGLYGV++G   FGESMFS   + SKI    L
Sbjct: 112 EDIVQGYVELFKAGYAYSVEVWENDQLIGGLYGVNIGKGCFGESMFSLRTDTSKIAFYTL 171

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +   ++ Q   +D Q + +HL   GA  ++   Y K L++ +  P I++
Sbjct: 172 MLIGQENQVPWVDCQLVNDHLISLGACTLSRQAYLKSLQDVIIQPPINW 220


>gi|189463816|ref|ZP_03012601.1| hypothetical protein BACINT_00149 [Bacteroides intestinalis DSM
           17393]
 gi|189438766|gb|EDV07751.1| hypothetical protein BACINT_00149 [Bacteroides intestinalis DSM
           17393]
          Length = 212

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 92/160 (57%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  PL R +I  +  H    ++  I +  YD+ IN AF+ VI  C +        W+ 
Sbjct: 53  IQWWCPLERFVIFPDEIHISHSMRTLINKGKYDVTINQAFDEVIRKCGELRMDMEGAWLG 112

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L   G+A ++E W+ + LVGGLYGV+LG  FFGESMFS + +ASK+ L HL
Sbjct: 113 PEMIEAYTLLHEQGFAASVEIWEGEQLVGGLYGVTLGRCFFGESMFSLVPSASKLALIHL 172

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            +   +   +L+D QF T HL+  G   I++ +Y +LL++
Sbjct: 173 AQFFGEHGGVLIDCQFETPHLKSMGGRYISYEEYMELLQS 212


>gi|114047226|ref|YP_737776.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sp. MR-7]
 gi|123030672|sp|Q0HVY6|LFTR_SHESR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|113888668|gb|ABI42719.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sp. MR-7]
          Length = 236

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 92/163 (56%), Gaps = 1/163 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N+ D I W  P  R I      +    L+KY++++ +   IN AF  V++ CAQ  +K+ 
Sbjct: 52  NADDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWHFTINHAFTDVMAGCAQPRRKQA 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH++E W  + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITHEIQMAYRELHHNGHAHSVEVWHGERLIGGLYGLAIGQVFCGESMFHRETNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  L +HL    F L+D Q +  HL   GA  +    + +LL
Sbjct: 172 AMLLLQQHLINMDFKLIDAQVMNPHLESLGAKPVKRANFIQLL 214


>gi|110834149|ref|YP_693008.1| leucyl/phenylalanyl-tRNA--protein transferase [Alcanivorax
           borkumensis SK2]
 gi|118572929|sp|Q0VQ12|LFTR_ALCBS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|110647260|emb|CAL16736.1| aminoacyltransferase [Alcanivorax borkumensis SK2]
          Length = 242

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 81/152 (53%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
            A SQ I W  P  R +I LE  H  + L +++RR  + +  + AFE+V+  CA   Q  
Sbjct: 49  DAESQPILWWSPAPRCVIQLEQLHVSRSLARHLRRADFTVTFDRAFETVMRTCAAPRQDE 108

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  +  AY  L  +GYAH++E W+   L G LYG+ LG +FFGESM S   N SK
Sbjct: 109 AGTWISEDMLAAYCRLHELGYAHSVEIWQNGALAGCLYGIQLGQMFFGESMASPQRNGSK 168

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
           + L  L    +K    LLD Q    HL   GA
Sbjct: 169 VALVALRNFARKLDIQLLDAQIENPHLMSMGA 200


>gi|126663053|ref|ZP_01734051.1| leu/phe-tRNA-protein transferase [Flavobacteria bacterium BAL38]
 gi|126624711|gb|EAZ95401.1| leu/phe-tRNA-protein transferase [Flavobacteria bacterium BAL38]
          Length = 211

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 91/164 (55%), Gaps = 1/164 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RP 64
           + + I W  P  R ++  E     K ++  I ++ + +  NTAF  VI  C + ++K +P
Sbjct: 47  DDEPILWWSPPERMVLFFEDLKISKSMRNIINQKKFKVTFNTAFRDVILNCKKISRKDQP 106

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G A ++E W+ D LVGGLYGV LG VF GESMFS + NASK+
Sbjct: 107 GTWITDNMVEAYCKLHELGIAKSVEVWQNDELVGGLYGVDLGHVFCGESMFSKVSNASKL 166

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
               L K L+   + LLD Q   +HL   G +EI    +  +L+
Sbjct: 167 AFIALAKQLEMANYRLLDCQVYNDHLDSLGCVEIEREDFLMVLK 210


>gi|324113819|gb|EGC07794.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia
           fergusonii B253]
 gi|325496829|gb|EGC94688.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia
           fergusonii ECD227]
          Length = 234

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W+KD LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWRKDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|218688673|ref|YP_002396885.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           ED1a]
 gi|254809119|sp|B7MRU8|LFTR_ECO81 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|218426237|emb|CAR07062.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           ED1a]
          Length = 234

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + KAY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVKAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|115351510|ref|YP_773349.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           ambifaria AMMD]
 gi|170698700|ref|ZP_02889766.1| Leucyltransferase [Burkholderia ambifaria IOP40-10]
 gi|172060529|ref|YP_001808181.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           ambifaria MC40-6]
 gi|122323331|sp|Q0BFQ8|LFTR_BURCM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226736112|sp|B1YPI8|LFTR_BURA4 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|115281498|gb|ABI87015.1| Leucyltransferase [Burkholderia ambifaria AMMD]
 gi|170136404|gb|EDT04666.1| Leucyltransferase [Burkholderia ambifaria IOP40-10]
 gi|171993046|gb|ACB63965.1| Leucyltransferase [Burkholderia ambifaria MC40-6]
          Length = 254

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F     L+K +RR L    +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLRRVLREPAWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     +GGLYGV+ G +FFGESM++   
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRIGGLYGVAFGRMFFGESMYADAT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL+++   ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|113969991|ref|YP_733784.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sp. MR-4]
 gi|123325108|sp|Q0HJP0|LFTR_SHESM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|113884675|gb|ABI38727.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sp. MR-4]
          Length = 236

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 92/163 (56%), Gaps = 1/163 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N+ D I W  P  R I      +    L+KY++++ +   IN AF  V++ CAQ  +K+ 
Sbjct: 52  NADDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWRFTINHAFTDVMAGCAQPRRKQA 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L + G+AH++E W  + L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITHEIQMAYRELHHNGHAHSVEVWHGERLIGGLYGLAIGQVFCGESMFHRETNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  L +HL    F L+D Q +  HL   GA  +    + +LL
Sbjct: 172 AMLLLQQHLINMDFKLIDAQVMNPHLESLGAKPVKRANFIQLL 214


>gi|218548407|ref|YP_002382198.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia
           fergusonii ATCC 35469]
 gi|226737698|sp|B7LN53|LFTR_ESCF3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|218355948|emb|CAQ88564.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia
           fergusonii ATCC 35469]
          Length = 234

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W+KD LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWRKDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L        +    L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|172035000|ref|YP_001801501.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp. ATCC
           51142]
 gi|171696454|gb|ACB49435.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp. ATCC
           51142]
          Length = 194

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 7/175 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +   + W    +R +IPL E FH PK LK+ + + ++ + IN  F  V   CA  
Sbjct: 22  MADENDV--LGWYSSRQRALIPLDERFHYPKSLKRVLNQNIFSVAINRNFLGVCYGCA-- 77

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI   +   Y  L   GYAH+ E W+ + L GG+ G++LG  F GESMF  + 
Sbjct: 78  --DRKTTWIAPELIDIYYQLHLAGYAHSFETWQGNELAGGILGITLGGAFIGESMFFRIP 135

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           N SK+ +  LV+HL++R F L D Q   +HL +FG+  ++ ++Y K L++ALK+P
Sbjct: 136 NGSKVAMVKLVEHLRQRGFTLFDAQLQNDHLARFGSYLVSEIEYQKFLQDALKNP 190


>gi|212634698|ref|YP_002311223.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           piezotolerans WP3]
 gi|226737723|sp|B8CLI5|LFTR_SHEPW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|212556182|gb|ACJ28636.1| Leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           piezotolerans WP3]
          Length = 236

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 88/159 (55%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +         + L KY++++ +   IN  F +VI  CA    K+  TWI+
Sbjct: 57  ILWWSPDPRAVFAPGNLRVSRSLIKYLKKQSWTFSINKQFPAVIRGCAAPRAKQEETWIS 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             IQ+AY+ L   G+AH+IE W+ D+L+GGLYG+++G VF GESMF    NASK  +  L
Sbjct: 117 DDIQQAYLSLHQQGHAHSIEVWEDDILIGGLYGLAIGQVFCGESMFHLRTNASKAAMIVL 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +HL +  F L+D Q    HL   GA  I    +  LL+
Sbjct: 177 QQHLLRCGFKLIDAQVENPHLDSLGAKSIKRKDFLTLLK 215


>gi|296157672|ref|ZP_06840506.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           Ch1-1]
 gi|295891918|gb|EFG71702.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           Ch1-1]
          Length = 245

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 101/179 (56%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F     L+K +RR L D    IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLRRVLRDDAWEIRVDHDFAAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   + +AY  L  +G AH+IE W +   VGGLYGVS G +FFGESMF+ + 
Sbjct: 112 RRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGRRVGGLYGVSFGKMFFGESMFAEVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASK+ L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  +++ P I +
Sbjct: 172 DASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVEAPPIPW 230


>gi|87122215|ref|ZP_01078098.1| Leucyltransferase [Marinomonas sp. MED121]
 gi|86162535|gb|EAQ63817.1| Leucyltransferase [Marinomonas sp. MED121]
          Length = 241

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 98/168 (58%), Gaps = 2/168 (1%)

Query: 5   ANSQDISWIKPLRRG-IIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           +++  I W  P +R  ++P E FH  K LKK+ +R    I+INTAF   I  C Q+ Q+ 
Sbjct: 55  SDADPILWWHPAQRCQLLPYE-FHLSKSLKKHTKRFSGSIKINTAFHETIQYCRQQRQEM 113

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  IQ+A+  L  +G+AH+IE WK + L+GGLYG++LG  FFGESMFS   NASK
Sbjct: 114 EGTWISNDIQQAFTLLHKLGFAHSIEVWKDESLIGGLYGIALGEFFFGESMFSLEANASK 173

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           + L  L  +        +D Q  ++HL   GA  I    + + L+ A+
Sbjct: 174 LALHSLCLNADILGIKYIDCQVESDHLMSLGARLIPRNDFIQQLKQAI 221


>gi|288801354|ref|ZP_06406808.1| leucyltransferase [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331737|gb|EFC70221.1| leucyltransferase [Prevotella sp. oral taxon 299 str. F0039]
          Length = 225

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 92/165 (55%)

Query: 9   DISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           +I W  PL+R +I  +  H    ++K IR   Y I +NTAF+ VI  C++        W+
Sbjct: 53  EIMWYCPLKRFVIFPDEIHISHSMRKVIRDNRYKITLNTAFDDVIRNCSELRINERGAWL 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              I KAY +L   G+A ++E W  + LVGGLYGV L    FGESMFS + NASK+ L  
Sbjct: 113 GPDIIKAYTELHKEGFAMSVEVWDDEKLVGGLYGVVLDGDVFGESMFSLVPNASKLALIA 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           L K +K+    ++D QF T HL+  G   I + +Y  LL  ++ H
Sbjct: 173 LAKFVKQMGGSIIDCQFETPHLKSMGGRYIDYDEYIDLLGVSVPH 217


>gi|300770164|ref|ZP_07080043.1| leucyltransferase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762640|gb|EFK59457.1| leucyltransferase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 210

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 91/164 (55%), Gaps = 4/164 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           ++   I W  P  R +I  E     K +K+ +R+  + + +NT FE VI  CA+  +K +
Sbjct: 48  SDDSPILWYAPHERFVIFPERLKVSKSMKQVLRKAEFKVTVNTVFEQVIRQCAKIERKDQ 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +  AYI L   GYAH IE W++D LVGGLYGV +G VF GESMFS + NASK
Sbjct: 108 DGTWITNDMIDAYIGLHKSGYAHAIEVWQEDQLVGGLYGVLIGQVFCGESMFSKVPNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             L HL +    +    +D QF T+HL   G   I+   Y  +L
Sbjct: 168 TALIHLFQFFDLK---FVDCQFHTDHLASMGGEMISQEDYLNIL 208


>gi|317402160|gb|EFV82751.1| leucyl/phenylalanyl-tRNA-protein transferase [Achromobacter
           xylosoxidans C54]
          Length = 251

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 97/183 (53%), Gaps = 9/183 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR---------ELYDIRINTAFESVISA 55
           +  + I W  P  R ++  + F     L+K +R+            ++R++TAF +V++ 
Sbjct: 50  SEGEPILWWSPDPRMVLACQDFAPSHSLRKLLRQVASHEHEAAPRIEVRVDTAFATVMAE 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA   + +P TWI   +++AY      GY H++E W    L GGLYG+SLG +FFGESMF
Sbjct: 110 CAAPREGQPGTWITAAMRQAYRAWHEAGYVHSVETWIDGELAGGLYGISLGRMFFGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           +   NASKI L +LV+++  +    +D Q  T HL   GA  I   ++   +  A   P 
Sbjct: 170 TRAPNASKIALAYLVRYVSAQGVQWIDCQQQTRHLASLGARPIPRSRFLAHIRAATSRPA 229

Query: 176 ISF 178
           I++
Sbjct: 230 IAW 232


>gi|293396845|ref|ZP_06641119.1| leucyltransferase [Serratia odorifera DSM 4582]
 gi|291420316|gb|EFE93571.1| leucyltransferase [Serratia odorifera DSM 4582]
          Length = 241

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 93/161 (57%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++  +  H  +  K+++R   + I +N  F +VI+ACA++  +   T
Sbjct: 53  GEAILWWSPDPRAVLFPDERHLSRSFKRFLRGNPFRITLNHNFSAVIAACAERPLE--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +Q+AY+ L  +G+AH++E W+ + LVGG+YGV+ GA+F GESMFS  +NASK  L
Sbjct: 111 WIGPEVQRAYLQLHQLGHAHSVEVWQGEQLVGGMYGVAQGALFCGESMFSRTDNASKCAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +H       L+D Q +  H  + GA EI   Q+ + L
Sbjct: 171 MAFCQHFSAFGGELIDCQVLNAHTSRLGAREIPRRQFLQQL 211


>gi|255319923|ref|ZP_05361124.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           radioresistens SK82]
 gi|262379183|ref|ZP_06072339.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter
           radioresistens SH164]
 gi|255303056|gb|EET82272.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           radioresistens SK82]
 gi|262298640|gb|EEY86553.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter
           radioresistens SH164]
          Length = 243

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 90/171 (52%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R +I  E +   K L + +++  Y I +N AFE VIS+CA        TW
Sbjct: 52  EPICWWSPEPRCVIYPECYKPSKSLLRSMKKYNYHITVNQAFEQVISSCALPRSYSEETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y DLF  G+ ++IE W    LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISKQIIQGYCDLFNAGFGYSIEVWDDTKLVGGLYGVTIGKGCFGESMFSTRTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   K+     +D Q +  HL   GA  ++   Y K L++ +  P I +
Sbjct: 172 SLMLIAKENNLPWVDCQLVNEHLLSLGACTVSRQDYLKSLQDVIIQPTIDW 222


>gi|171317510|ref|ZP_02906700.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia
           ambifaria MEX-5]
 gi|171097339|gb|EDT42184.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia
           ambifaria MEX-5]
          Length = 254

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 98/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F     L+K +RR L    +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLRRVLREPAWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W +   +GGLYGV+ G +FFGESM++   
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHEGRRIGGLYGVAFGRMFFGESMYADAT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  L+ HL+++   ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALATLIAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|315126402|ref|YP_004068405.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudoalteromonas
           sp. SM9913]
 gi|315014916|gb|ADT68254.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudoalteromonas
           sp. SM9913]
          Length = 238

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (53%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  RGI+ L  FH  K L+K++++    + IN AFE VI AC  +      TW
Sbjct: 56  EPIMWWSPSERGIVELNDFHVSKSLRKHLKKHPVTVTINHAFEEVIEACRDQRIDTDGTW 115

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I   +Q+AYI+  + G AH++E W++  L GGLYG+    VF GESMF H  N SK+ + 
Sbjct: 116 ITPQMQQAYINAHHHGIAHSLEVWREGELAGGLYGIMQTGVFCGESMFHHQTNCSKLAMW 175

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
            LV  LK+     +D Q    +L   GA  ++  ++   L  A
Sbjct: 176 ALVNWLKRHNAHFIDCQLENPYLMSLGASVVSREEFLTKLNKA 218


>gi|294636950|ref|ZP_06715274.1| leucyltransferase [Edwardsiella tarda ATCC 23685]
 gi|291089843|gb|EFE22404.1| leucyltransferase [Edwardsiella tarda ATCC 23685]
          Length = 242

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 90/163 (55%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R ++     H    L+K  RR    + +N  F  VI+ CA++  +  
Sbjct: 51  SPGQLILWWSPDPRAVLSPAALHISHSLRKAARRTPLRVTLNHDFAGVIAGCAER--RSD 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI  ++Q+AY  L  +G+AH++E W+ + LVGGLYGV+LG +F GESMFS + NASK+
Sbjct: 109 GTWIGPSVQQAYGQLHRLGHAHSVEVWQGEQLVGGLYGVALGTLFCGESMFSRVSNASKM 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +H +     L+D Q + +H    GA EI    Y + L
Sbjct: 169 ALWSFCRHFQAMGGQLIDCQVLNSHTASLGAEEIPRRHYLQQL 211


>gi|167587286|ref|ZP_02379674.1| Leucyltransferase [Burkholderia ubonensis Bu]
          Length = 254

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 96/179 (53%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F     LKK +RR L    +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFKVSPSLKKTLRRVLREPAWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGV+ G +FFGESMF+ + 
Sbjct: 112 RRGQRGTWITAEIIDAYTALHRTGNAHSIETWHDGRRVGGLYGVAFGRMFFGESMFADVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL++    ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALATLVAHLREHGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|254445646|ref|ZP_05059122.1| leucyl/phenylalanyl-tRNA--protein transferase [Verrucomicrobiae
           bacterium DG1235]
 gi|198259954|gb|EDY84262.1| leucyl/phenylalanyl-tRNA--protein transferase [Verrucomicrobiae
           bacterium DG1235]
          Length = 227

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 94/170 (55%), Gaps = 1/170 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +    I W  P  R ++    F     L + +R   +++RI+  F  VI++CA+  +  +
Sbjct: 48  SEGDPILWFSPNPRMVLYTHKFKRSATLARLVRSGKFELRIDANFPRVIASCAKAPRPGQ 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +QKAYI L  +G AH+ E +++  LVGGLYGVSLG+ FFGESMF H  +ASK
Sbjct: 108 DGTWITGEMQKAYIRLHELGLAHSFETYREGKLVGGLYGVSLGSAFFGESMFHHERDASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
              + LV   +K  F  +D Q  T HL+  GA E+   ++   L  A K+
Sbjct: 168 FAFSGLVDFAEKNHFEFIDAQQPTAHLKSLGAEEVPRTRFLHELAAAQKN 217


>gi|82777593|ref|YP_403942.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella dysenteriae
           Sd197]
 gi|309784002|ref|ZP_07678646.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella dysenteriae
           1617]
 gi|119367726|sp|Q32E04|LFTR_SHIDS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|81241741|gb|ABB62451.1| leucyl, phenylalanyl-tRNA-protein transferase [Shigella dysenteriae
           Sd197]
 gi|308928145|gb|EFP73608.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella dysenteriae
           1617]
          Length = 234

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L  L +        L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVLCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|254252490|ref|ZP_04945808.1| Leu/Phe-tRNA-protein transferase [Burkholderia dolosa AUO158]
 gi|124895099|gb|EAY68979.1| Leu/Phe-tRNA-protein transferase [Burkholderia dolosa AUO158]
          Length = 254

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGI-IPLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I +P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLRDPAWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L+  G AH+IE W     VGGLYGV+ G +FFGESM++   
Sbjct: 112 RRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVAFGRMFFGESMYAEAT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL+     ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 172 DASKIALAALVAHLRGHGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPW 230


>gi|146311066|ref|YP_001176140.1| leucyl/phenylalanyl-tRNA--protein transferase [Enterobacter sp.
           638]
 gi|166990807|sp|A4W8Q9|LFTR_ENT38 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|145317942|gb|ABP60089.1| Leucyltransferase [Enterobacter sp. 638]
          Length = 234

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 83/160 (51%), Gaps = 2/160 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R I+    FH  + +K++  +  Y + +N AF  VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAILEPSQFHLSRSMKRFHAKSPYRVTLNYAFGQVIEGCAADRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I  AY+ L  +GYAH+IE W  D LVGG+YGV+ G +F GESMFS   NASK  L   
Sbjct: 114 HDIINAYLRLHELGYAHSIEVWDNDTLVGGMYGVAQGTLFCGESMFSRAVNASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            +    R   L+D Q +  H    GA+EIT   Y   L N
Sbjct: 174 CQEFSLRGGQLMDCQVLNEHTASLGAVEITRRHYLDELGN 213


>gi|168236864|ref|ZP_02661922.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|194737506|ref|YP_002114007.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|204929823|ref|ZP_03220844.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|226737722|sp|B4TRR7|LFTR_SALSV RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|194713008|gb|ACF92229.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197290212|gb|EDY29569.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|204320817|gb|EDZ06018.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
          Length = 234

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q I +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFTRHGGKLIDCQVINSHTASLGAIEIPRRDYLDHLAALRQQP 218


>gi|94499674|ref|ZP_01306211.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanobacter sp.
           RED65]
 gi|94428428|gb|EAT13401.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanobacter sp.
           RED65]
          Length = 231

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 97/172 (56%), Gaps = 8/172 (4%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  +T+ T + L+K++R++ +++ I+  FE V+  CA     R  TWIN
Sbjct: 58  ILWWSPDPRSVLIPKTYKTSRSLQKFMRKQEHEVTIDQCFEQVMINCATT---REETWIN 114

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L  +G AH++E W+   L+GGLYG+S+G  FFGESMFS   NASK+  T L
Sbjct: 115 DAMLHAYCTLHELGIAHSVEYWQGKQLMGGLYGLSIGGAFFGESMFSKCSNASKVAFTRL 174

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY----AKLLENALK-HPEI 176
            +   +    L+D Q    HL   GAIEI    +    +KL+   +K  PEI
Sbjct: 175 CQLCNELGIELIDCQVHNPHLASLGAIEINRKDFLAKISKLINKPVKWQPEI 226


>gi|215486015|ref|YP_002328446.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|254809117|sp|B7UMX6|LFTR_ECO27 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|215264087|emb|CAS08429.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O127:H6 str. E2348/69]
          Length = 234

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +   +    L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFIRHGGKLIDCQILNDHTASLGACEIPRRDYLNYL 211


>gi|157369919|ref|YP_001477908.1| leucyl/phenylalanyl-tRNA--protein transferase [Serratia
           proteamaculans 568]
 gi|166990810|sp|A8GCE0|LFTR_SERP5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|157321683|gb|ABV40780.1| Leucyltransferase [Serratia proteamaculans 568]
          Length = 241

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 88/155 (56%), Gaps = 2/155 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++     H  + LK+++R   + + +N  F +VI+ACA + ++  
Sbjct: 51  SPGEAILWWSPDPRAVLFPAERHISRSLKRFLRSNPFRVTLNHDFAAVIAACADRPEE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +Q+AY+ L  +G+AH+IE W+ D LVGG+YGV+ GA+F GESMFS   NASK 
Sbjct: 109 GTWIGPEVQRAYLHLHRLGFAHSIEVWQGDELVGGMYGVAQGALFCGESMFSRTTNASKC 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
            L    +H       L+D Q +  H    GA EI 
Sbjct: 169 ALMTFCRHFAAYGGELIDCQVLNAHTATLGAKEIP 203


>gi|315637054|ref|ZP_07892277.1| leucyltransferase [Arcobacter butzleri JV22]
 gi|315478590|gb|EFU69300.1| leucyltransferase [Arcobacter butzleri JV22]
          Length = 222

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 94/162 (58%), Gaps = 1/162 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P +R ++  E F   K L+K I  + + ++ N  FE VI +CA+ K +    TWI
Sbjct: 61  IHWFSPQKRMVLYPENFKVSKSLRKSITNKGFVVKSNENFEEVIKSCAKIKRKHEDDTWI 120

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +    KAY +L  +  A +IE + KD LVGGLYGV +G +F GESMFS + +ASK+   H
Sbjct: 121 SEEFIKAYTNLHELDIAFSIECYLKDELVGGLYGVLIGDIFCGESMFSLVPDASKVAFYH 180

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           L +  K+    ++D Q   +HL   GA EIT  +Y  LL+++
Sbjct: 181 LCQQAKQNGIKIIDCQVYNDHLASLGAFEITRNEYFNLLKDS 222


>gi|294140601|ref|YP_003556579.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella violacea
           DSS12]
 gi|293327070|dbj|BAJ01801.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella violacea
           DSS12]
          Length = 236

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 86/159 (54%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +    T    + L KY++++ +   IN AFE VI  CAQ    +  TWI 
Sbjct: 57  ILWWSPDPRAVFVPGTMKVSRSLIKYLKKQTWTYSINRAFEEVIQGCAQPRVTQDGTWIT 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             IQ+AY+ L   G  H++E W   +L+GGLYGV++G VF GESMF    NASK  +  L
Sbjct: 117 TEIQQAYLALHNQGKVHSVEVWDNGMLIGGLYGVAIGQVFCGESMFHTQTNASKAAMLML 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +HL  + F L+D Q +  HL   GA  +    +  LL+
Sbjct: 177 HQHLLSKGFKLIDAQVMNPHLVSLGASALKRKDFINLLK 215


>gi|307152079|ref|YP_003887463.1| leucyl/phenylalanyl-tRNA/protein transferase [Cyanothece sp. PCC
           7822]
 gi|306982307|gb|ADN14188.1| leucyl/phenylalanyl-tRNA/protein transferase [Cyanothece sp. PCC
           7822]
          Length = 195

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 98/174 (56%), Gaps = 7/174 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           M+D   +  + W    +R +IPL+  F  P+ L++ + ++ + + IN  F SV +ACA  
Sbjct: 23  MSDEDGT--LGWYTSRQRTLIPLDDRFRYPRSLQRVLNQQKFTVAINRDFPSVCAACA-- 78

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  +   Y+ L   G+A + E W  D L GG+ G+ +   F GESMF  + 
Sbjct: 79  --DRETTWISGELIDIYLQLHQAGWAFSFETWLGDQLAGGILGIVIRGAFIGESMFYRIP 136

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           + SK+ +  LV+HLK+R F+L D Q    HL +FG+  IT  +Y  LL+ AL H
Sbjct: 137 DGSKVAMVKLVEHLKQRGFVLFDAQLQNPHLARFGSYCITDREYQVLLKRALSH 190


>gi|260909907|ref|ZP_05916595.1| leucyltransferase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260635952|gb|EEX53954.1| leucyltransferase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 214

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 92/163 (56%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           +++I W  P++R +I     H    ++  + R  Y +  N  F+ VI  C++   K    
Sbjct: 51  NREILWYCPMQRFVIFPSEVHVSHSMRSLMSRGTYHVTFNQEFDEVIRRCSRLRIKEDGA 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+ + + KAY  +   G+A ++E W+ D LVGGLYGV++G  FFGESMFS + +ASK+ L
Sbjct: 111 WLGVDMVKAYRKMHEQGFAASVEVWQSDRLVGGLYGVTIGRCFFGESMFSLVPSASKLAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            HL  ++     LL+D QF T HLR  G   I +  Y K+++ 
Sbjct: 171 IHLAHYMNDNGGLLIDCQFETPHLRSMGGRFIAYDDYLKIIQQ 213


>gi|312969047|ref|ZP_07783254.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           2362-75]
 gi|312286449|gb|EFR14362.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           2362-75]
          Length = 234

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 88/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +   +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CEEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|288929192|ref|ZP_06423037.1| leucyltransferase [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329294|gb|EFC67880.1| leucyltransferase [Prevotella sp. oral taxon 317 str. F0108]
          Length = 214

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 91/162 (56%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           +++I W  P++R +I     H    ++  I R  Y +  N  F+ VI  C++   K    
Sbjct: 51  NREILWYCPMQRFVIFPAEVHVSHSMRSLINRGTYHVTFNQEFDEVIRHCSRLRIKEDGA 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+ + + KAY  +   G+A ++E W+ D LVGGLYGV+LG  FFGESMFS   +ASK+ L
Sbjct: 111 WLGVDMVKAYRKMHEQGFAASVEVWQSDRLVGGLYGVTLGRCFFGESMFSLAPSASKLAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            HL  ++     L++D QF T HLR  G   I +  Y K+++
Sbjct: 171 IHLAHYMSDHGGLIIDCQFETPHLRSMGGRFIAYDDYLKIIQ 212


>gi|145299393|ref|YP_001142234.1| leucyl/phenylalanyl-tRNA--protein transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142852165|gb|ABO90486.1| leucyl/phenylalanyl-tRNA--protein transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 245

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 88/167 (52%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q + W  P  RG+I  E  H  + L+K+IRR  +DI IN AF  VI+ACA   +    TW
Sbjct: 66  QPLLWWSPDPRGVIIPEQLHIGRSLRKFIRRTSFDISINRAFNEVIAACAAPRRSASGTW 125

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  +  AY  L  +G+AH++E W+   L  GLYG+SLG +F GESMFS ++N +K+ + 
Sbjct: 126 ISTPMIDAYRQLHRLGHAHSVEIWQHGQLQAGLYGLSLGRLFCGESMFSRIDNGAKLAMV 185

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L  H       L+D Q   + L   G  E     +   L    + P
Sbjct: 186 ALCHHFASHGGALIDCQMQNDFLATMGIQEWPRETFLTALTKLSRQP 232


>gi|300312519|ref|YP_003776611.1| leucyl/phenylalanyl-tRNA-protein transferase [Herbaspirillum
           seropedicae SmR1]
 gi|300075304|gb|ADJ64703.1| leucyl/phenylalanyl-tRNA-protein transferase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 247

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 96/180 (53%), Gaps = 8/180 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR--------ELYDIRINTAFESVISAC 56
           +  Q I W     R ++  + F     LKK +RR         L+ +  +TAFE V+  C
Sbjct: 49  SEGQPILWWSTDPRMVLRTDQFVVSDSLKKTLRRIERSRQGDGLWQVSFDTAFEQVMQGC 108

Query: 57  AQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFS 116
           A   +    TWI+  I + Y+ L   GYAH+ E W    LVGG YGVS+G +F+GESMF+
Sbjct: 109 AGPRRHEHGTWISPDIMQGYLGLHLAGYAHSAEVWLNGELVGGAYGVSIGRMFYGESMFA 168

Query: 117 HMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
            + +ASK+ L HLV  L+     ++D Q  T+HL   GA  I   ++ + L  A++ P+I
Sbjct: 169 RVSDASKVALAHLVFFLRSHGVEMIDCQQETSHLASLGARPIARSEFLRHLRAAIQWPQI 228


>gi|78357141|ref|YP_388590.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|119367695|sp|Q30ZK1|LFTR_DESDG RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|78219546|gb|ABB38895.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 248

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 100/175 (57%), Gaps = 6/175 (3%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RP 64
           +   I W  P  R ++     H P  L++ I    +++ ++TAFE+VI ACA   +  + 
Sbjct: 49  DDTPILWWSPDPRCVLYPSQLHVPASLRRRINSGQFEVTLDTAFEAVIHACADAARPGQS 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKD-----VLVGGLYGVSLGAVFFGESMFSHME 119
            TWI   +  AY++L   G AH++E W +      VL GGLYGV+LG VF+GESMF    
Sbjct: 109 GTWIVDEMIDAYMNLHEAGVAHSVEVWSRGAGDGRVLAGGLYGVALGGVFYGESMFYRRT 168

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           +ASK+ +  LV+ L+   + ++D Q  T H+ +FGA E++   + + L+ AL+ P
Sbjct: 169 DASKVAVVWLVRLLEFWGYRVVDCQQTTTHMLRFGAQEVSRACFLEELDRALRMP 223


>gi|270293655|ref|ZP_06199857.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp. D20]
 gi|317479381|ref|ZP_07938515.1| leucyl/phenylalanyl-tRNA protein transferase [Bacteroides sp.
           4_1_36]
 gi|270275122|gb|EFA20982.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp. D20]
 gi|316904455|gb|EFV26275.1| leucyl/phenylalanyl-tRNA protein transferase [Bacteroides sp.
           4_1_36]
          Length = 216

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 93/163 (57%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P+ R +I  +  H    ++  I +  Y+I  N AF+ +I  C +   ++   W+ 
Sbjct: 53  IQWWCPMDRFVIFPDEIHISHSMRTLINKGKYEITFNEAFQDIIQTCGELRMEQEGAWLG 112

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L   G+A ++E W+++ LVGGLYGV+LG  FFGESMFS + +ASK+ L HL
Sbjct: 113 TKMMEAYTHLHEQGFAASVEVWEEEQLVGGLYGVTLGRCFFGESMFSLVPSASKLALIHL 172

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            +  ++   +++D QF T HL+  G   I++ +Y   +E   +
Sbjct: 173 AQFFREHGGVMIDCQFETPHLKTMGGRHISYDEYMTYIEQDCR 215


>gi|262280039|ref|ZP_06057824.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter
           calcoaceticus RUH2202]
 gi|262260390|gb|EEY79123.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter
           calcoaceticus RUH2202]
          Length = 243

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 98/172 (56%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           ++ I W  P  R +I  + +   K L + +++  Y I +N AFE VI +C+        T
Sbjct: 51  NEPICWWSPEPRCVIYPQNYKPSKSLLRNMKKYDYAITVNHAFEQVIRSCSLPRTYADET 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI+  I + Y ++F  GY +++E W++D LVGGLYG+++G   FGESMFS+  + SK+  
Sbjct: 111 WISEDIIQGYCEMFNAGYGYSVEVWEQDKLVGGLYGITIGKGCFGESMFSNETDVSKMAF 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
             L+   ++ Q   +D Q + +HL   GA  ++   Y K L++ + HP I++
Sbjct: 171 YTLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQDYLKSLQDVIIHPSINW 222


>gi|302879561|ref|YP_003848125.1| leucyl/phenylalanyl-tRNA/protein transferase [Gallionella
           capsiferriformans ES-2]
 gi|302582350|gb|ADL56361.1| leucyl/phenylalanyl-tRNA/protein transferase [Gallionella
           capsiferriformans ES-2]
          Length = 219

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 93/159 (58%), Gaps = 4/159 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + + W  P  R ++    F     L K +R   +++RI++AFE V+  CA     +P
Sbjct: 49  SPGEPLLWWSPDPRMVLIPGEFKLSGSLAKVLRSSAFELRIDSAFEQVMKECAAPRGDQP 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  +  AY++L  +G+AH+IE+W+   L GGLYGV++G +F+GESMFS + NASKI
Sbjct: 109 GTWISDEMIAAYVELHRLGHAHSIESWQNGKLAGGLYGVAIGRMFYGESMFSRVSNASKI 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            L HL     ++ + L+D Q  T HL   GA  +   Q+
Sbjct: 169 ALHHLC----QQPYDLIDCQMHTPHLASLGARLLPRDQF 203


>gi|254786023|ref|YP_003073452.1| leucyl/phenylalanyl-tRNA--protein transferase [Teredinibacter
           turnerae T7901]
 gi|259494910|sp|C5BIJ8|LFTR_TERTT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|237685821|gb|ACR13085.1| leucyltransferase [Teredinibacter turnerae T7901]
          Length = 259

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 97/164 (59%), Gaps = 1/164 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           ++ Q + W  P  R ++     H  + L+K +R+  + + +++AF++V  AC   + + +
Sbjct: 52  SDGQPLLWWTPDPRMVLRPAHVHRGRTLRKLLRQHPFTVTVDSAFDAVAQACGTIEREGQ 111

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +  AY +L  +G AH++E W ++ LVGGLYG++LG VFFGESMFS +  ASK
Sbjct: 112 DGTWITQEMLAAYSELNRLGVAHSLEVWLQNELVGGLYGIALGTVFFGESMFSRVSGASK 171

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           +  + L + L+   F L+D Q  + +L  FGA EI    + KLL
Sbjct: 172 VGFSILCQQLENWGFELVDCQIHSGYLASFGAQEIPRATFEKLL 215


>gi|163751222|ref|ZP_02158450.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella benthica
           KT99]
 gi|161328936|gb|EDQ00010.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella benthica
           KT99]
          Length = 236

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 86/159 (54%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +    +    + L KY++++ +   IN AFE+VI  CAQ    +  TWI 
Sbjct: 57  ILWWSPDPRAVFVPGSMKASRSLIKYLKKQTWTYSINQAFEAVIKGCAQPRVAQDGTWIT 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             IQ+AY+ L + G  H++E W    L+GGLYGV++G VF GESMF    N SK  +  L
Sbjct: 117 TEIQQAYLTLHHQGKVHSVEIWDNGALIGGLYGVAIGQVFCGESMFHTQTNVSKAAMLML 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +HL +  F L+D Q +  HL   GA  +    +  LL+
Sbjct: 177 HQHLLRNGFKLIDAQVMNPHLASLGATALKRKDFINLLK 215


>gi|149197720|ref|ZP_01874770.1| leucyl/phenylalanyl-tRNA--protein transferase [Lentisphaera
           araneosa HTCC2155]
 gi|149139290|gb|EDM27693.1| leucyl/phenylalanyl-tRNA--protein transferase [Lentisphaera
           araneosa HTCC2155]
          Length = 227

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 3/164 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++ LE +   K L + I++  ++++ ++AF  VI  CA     R  TWI+  
Sbjct: 52  WYSPDPRMVLDLENYRPSKSLLRRIKKGEFEVKYDSAFGGVIRCCAAL---RDDTWISED 108

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
             ++Y  L  MG AH+IE ++   LVGGLYG+S+G  FFGESMF  + +ASK+   +LV+
Sbjct: 109 FIESYTKLHEMGLAHSIETYQDGQLVGGLYGLSIGQAFFGESMFHTVTDASKVAFHYLVR 168

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
             +K  F LLD Q   +HL   G  +I    Y  LL+ AL  P+
Sbjct: 169 QSQKWAFDLLDCQINNDHLLSLGGKDIPRDDYMDLLKEALSKPK 212


>gi|269468909|gb|EEZ80496.1| Leu/Phe-tRNA-protein transferase [uncultured SUP05 cluster
           bacterium]
          Length = 219

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 4/155 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           +  + + W  P  R +I  +  H  K L K +  E +++R +T FE VI  C   K + +
Sbjct: 55  SEGEPVLWYSPNPRMVITKDKLHISKSLAKLLNSERFEVRTDTNFEQVIRQCKTIKRKDQ 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
            +TWI+  +  AY  L + G+AH+IE +++D L+GGLYGV++G VFFGESMFS   NASK
Sbjct: 115 SSTWIDDDMVVAYTKLHHQGHAHSIEVYEQDQLIGGLYGVAIGKVFFGESMFSCKSNASK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
           +   +L   L+K  + L+D Q   +HL+  GA  I
Sbjct: 175 VAFVYL---LQKTDYQLVDCQVENSHLKSLGAFNI 206


>gi|320196620|gb|EFW71243.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           WV_060327]
          Length = 234

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIRHGGKLIDCQVLNDHTASLGACEIPRWDYLNYL 211


>gi|224535857|ref|ZP_03676396.1| hypothetical protein BACCELL_00721 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522580|gb|EEF91685.1| hypothetical protein BACCELL_00721 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 212

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 91/160 (56%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  PL R +I  +  H    ++  I +  YD+ IN AF+ VI  C +        W+ 
Sbjct: 53  IQWWCPLERFVIFPDEIHISHSMRTLINKGKYDVTINQAFDEVIRKCGELRMDMEGAWLG 112

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L   G+A ++E W+ + LVGGLYGV+LG  FFGESMFS + +ASK+ L HL
Sbjct: 113 PEMIEAYTLLHEQGFAASVEIWEGEQLVGGLYGVTLGRCFFGESMFSLVPSASKLALIHL 172

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
            +   +   +L+D QF T HL+  G   I++ +Y + L++
Sbjct: 173 AQFFGEHGGVLIDCQFETPHLKSMGGRYISYEEYMEFLQS 212


>gi|91209930|ref|YP_539916.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           UTI89]
 gi|110641085|ref|YP_668815.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           536]
 gi|117623069|ref|YP_851982.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           APEC O1]
 gi|218557793|ref|YP_002390706.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           S88]
 gi|237707126|ref|ZP_04537607.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia sp.
           3_2_53FAA]
 gi|300983205|ref|ZP_07176484.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           200-1]
 gi|306812660|ref|ZP_07446853.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           NC101]
 gi|331656956|ref|ZP_08357918.1| leucyltransferase [Escherichia coli TA206]
 gi|118572934|sp|Q0TJG5|LFTR_ECOL5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119367696|sp|Q1RE29|LFTR_ECOUT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|158512539|sp|A1A9C8|LFTR_ECOK1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226736124|sp|B7MHJ7|LFTR_ECO45 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91071504|gb|ABE06385.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli
           UTI89]
 gi|110342677|gb|ABG68914.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli 536]
 gi|115512193|gb|ABJ00268.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli
           APEC O1]
 gi|218364562|emb|CAR02248.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli S88]
 gi|222032619|emb|CAP75358.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           LF82]
 gi|226898336|gb|EEH84595.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia sp.
           3_2_53FAA]
 gi|294492839|gb|ADE91595.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           IHE3034]
 gi|300306969|gb|EFJ61489.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           200-1]
 gi|305853423|gb|EFM53862.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           NC101]
 gi|307627685|gb|ADN71989.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           UM146]
 gi|312945408|gb|ADR26235.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315287273|gb|EFU46684.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           110-3]
 gi|315296147|gb|EFU55456.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           16-3]
 gi|323953405|gb|EGB49271.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           H252]
 gi|323958192|gb|EGB53901.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           H263]
 gi|324009821|gb|EGB79040.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           57-2]
 gi|331055204|gb|EGI27213.1| leucyltransferase [Escherichia coli TA206]
          Length = 234

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|281178019|dbj|BAI54349.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           SE15]
          Length = 234

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|283784707|ref|YP_003364572.1| leucyl/phenylalanyl-tRNA-protein transferase [Citrobacter rodentium
           ICC168]
 gi|282948161|emb|CBG87728.1| leucyl/phenylalanyl-tRNA-protein transferase [Citrobacter rodentium
           ICC168]
          Length = 234

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 87/159 (54%), Gaps = 2/159 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  + FH  + +K++ +R  Y + +N  F+  I+ CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPDAFHISRSMKRFHKRSPYRVTLNYTFDQTIAGCASDRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W+ D LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 PAVVEAYHRLHELGHAHSIEVWRNDELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
                +    L+D Q + +H    GA+EI    Y   L+
Sbjct: 174 CAEFLRAGGKLMDCQVLNDHTASLGAVEIPRRTYLDHLD 212


>gi|191172143|ref|ZP_03033687.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           F11]
 gi|190907670|gb|EDV67265.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           F11]
 gi|324012975|gb|EGB82194.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           60-1]
          Length = 234

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +    L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|238757598|ref|ZP_04618782.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia aldovae
           ATCC 35236]
 gi|238704103|gb|EEP96636.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia aldovae
           ATCC 35236]
          Length = 236

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 88/149 (59%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++RR  Y   +N AF  V++ACA  + +   TWI 
Sbjct: 56  ILWWSPNPRAVLFPEDLHISRSMRRFLRRCPYRFTLNHAFADVVNACA--SLRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYG+++G +F GESMFS  +NASK  L   
Sbjct: 114 DDVQQAYCQLHALGHAHSVEVWLENELVGGLYGITVGKLFCGESMFSRADNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  ++   L+D Q +  H    GAIEI
Sbjct: 174 CHHFTRQGGELIDCQVLNAHTASLGAIEI 202


>gi|317491431|ref|ZP_07949867.1| leucyl/phenylalanyl-tRNA protein transferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920978|gb|EFV42301.1| leucyl/phenylalanyl-tRNA protein transferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 243

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 84/154 (54%), Gaps = 2/154 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++     H  + + K++RR+ + + IN AF  VI  CA+  Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLFPHELHISRSMAKFLRRQRFTVTINQAFSEVIRECAE--QRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY+ L  +G+AH++E W++D LVGGLYGV  G++F GESMFS   NASK  L   
Sbjct: 114 EDVQQAYVKLHELGHAHSVEVWQEDRLVGGLYGVLQGSLFCGESMFSRATNASKTALIAF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
             H       L+D Q +  H    GA  I    Y
Sbjct: 174 CGHFVSFGGTLIDCQVLNAHTESLGARNIPRSDY 207


>gi|198245408|ref|YP_002214879.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|226737716|sp|B5FQ28|LFTR_SALDC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|197939924|gb|ACH77257.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|326622632|gb|EGE28977.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
          Length = 234

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGIYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + NH    GAIEI    Y   L    + P
Sbjct: 174 CAEFIRHGGKLIDCQVLNNHTASLGAIEILRRDYLDHLAALRQQP 218


>gi|85858019|ref|YP_460221.1| leucyl/phenylalanyl-tRNA--protein transferase [Syntrophus
           aciditrophicus SB]
 gi|119368212|sp|Q2LQL0|LFTR_SYNAS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|85721110|gb|ABC76053.1| leu/phe-tRNA-protein transferase [Syntrophus aciditrophicus SB]
          Length = 239

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 99/175 (56%), Gaps = 5/175 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++  +     + +++ +R++ + + ++  F++VI ACA  T  RP
Sbjct: 48  SPGEPILWWAPQPRFVLFPDEILLSRSMRQILRKKHFQVTLDRNFDAVIHACA--TIGRP 105

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AY  L  +GYAH++E W+   L+GGLYGVSLG  FFGESMFS   NA
Sbjct: 106 AQEGTWITEEMQEAYSILHELGYAHSVEVWRDRGLIGGLYGVSLGGCFFGESMFSRESNA 165

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           SK  L  L   LK  +F L+D Q  T+HL   GA  I    +  L+  +L+ P +
Sbjct: 166 SKAALIFLSSLLKILRFTLIDCQVYTSHLALLGARFIPRETFTALIRKSLRRPTL 220


>gi|332162225|ref|YP_004298802.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606288|emb|CBY27786.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666455|gb|ADZ43099.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330860570|emb|CBX70869.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           enterocolitica W22703]
          Length = 236

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 85/149 (57%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++R   Y   +N AFE V+ ACA  T +   TWI 
Sbjct: 56  ILWWSPDPRAVLYPEDLHISRSMRRFLRNCPYRFTLNHAFEDVVRACA--TLRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYG+S+G++F GESMFS   NASK  L   
Sbjct: 114 DDVQQAYCHLHTLGHAHSVEVWLENELVGGLYGISVGSLFCGESMFSRANNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H       L+D Q +  H    GAIEI
Sbjct: 174 CHHFTHHGGELIDCQVLNAHTASLGAIEI 202


>gi|116747495|ref|YP_844182.1| leucyl/phenylalanyl-tRNA--protein transferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|158512341|sp|A0LE95|LFTR_SYNFM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|116696559|gb|ABK15747.1| Leucyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 234

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP-TTWI 68
           I W  P  R ++          L++ +R+ ++ +  + AF  VI  CA+  + R  +TWI
Sbjct: 53  ILWWSPDPRLVLFPAELKISISLRRVLRKNVFSVTFDRAFADVIRRCAEVRRARDDSTWI 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AY  L  +GYAH++E+W +  LVGGLYGV+LG VF+GESMF+   +ASK+ L H
Sbjct: 113 VPGMVTAYSRLHRLGYAHSVESWHEGELVGGLYGVALGRVFYGESMFTRKTDASKVALVH 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           LV  L +  F L+D Q  T HL+  GA EI+  ++  LL   +  PE+
Sbjct: 173 LVDLLTRGGFQLIDCQVTTAHLQSMGAREISRRRFLTLLAENI--PEV 218


>gi|261252450|ref|ZP_05945023.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio orientalis
           CIP 102891]
 gi|260935841|gb|EEX91830.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio orientalis
           CIP 102891]
          Length = 242

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 94/171 (54%), Gaps = 4/171 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R     +TF   + LKK+ R++ Y + IN A ++VI  CA  T+    T
Sbjct: 55  GEPILWWSPSPRATFNPKTFKPSRSLKKFQRKQQYRVSINQATDAVIDYCA-STRAAEET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  ++ +Y  L   G+ H++E W  + LVGGLYG+S+G +F GESMFS   NASKI L
Sbjct: 114 WLNEEMRVSYKALAKQGHCHSVEVWSNNTLVGGLYGISIGQLFCGESMFSLEANASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL---ENALKHP 174
            +  +H +K    L+D Q +  HL   GA E+    + + L   +N   HP
Sbjct: 174 WYFCEHFQKHDGQLIDCQVMNPHLASLGAKELEREDFIQRLLSFKNQPLHP 224


>gi|319426620|gb|ADV54694.1| leucyl/phenylalanyl-tRNA/protein transferase [Shewanella
           putrefaciens 200]
          Length = 236

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 90/163 (55%), Gaps = 1/163 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N+ D I W  P  R I           L KY++++ +   IN AF SV++ CA+   K+ 
Sbjct: 52  NADDPILWWSPDPRAIFMPGKIRISTSLCKYLKKQPWHFTINHAFTSVMAGCAEPRPKQN 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY +L   G+AH+IE W+   L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITDEIQMAYRELHKNGHAHSIEVWEGGQLIGGLYGLAIGQVFCGESMFHRQTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  L +HL K  F L+D Q +  HL   GA  I    + +LL
Sbjct: 172 AIVVLQQHLVKMGFKLIDAQVMNPHLESLGAKTIKRTHFIELL 214


>gi|293609027|ref|ZP_06691330.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829600|gb|EFF87962.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 243

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 97/171 (56%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R +I  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCVIYPQNYKPSKSLLRNMKKHGYAITVNHAFEQVIRSCSLPRSYADETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y ++F  GY ++IE W+++ LVGGLYGV++G   FGESMFS+  + SK+   
Sbjct: 112 ISEDIIQGYCEMFNAGYGYSIEVWQQEELVGGLYGVTIGKGCFGESMFSNETDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++   Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWIDCQLVNSHLISLGASTLSRQDYLKSLQDVIIHPSINW 222


>gi|228472865|ref|ZP_04057622.1| leucyltransferase [Capnocytophaga gingivalis ATCC 33624]
 gi|228275447|gb|EEK14224.1| leucyltransferase [Capnocytophaga gingivalis ATCC 33624]
          Length = 226

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 2/163 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPT 65
            + I W  P +R ++  E +   K ++    +  Y +  N AF+ VI AC    +K +  
Sbjct: 48  DEPIIWWAPPKRMVVYPEHYSMHKSMRNVFNQHKYTVTFNKAFQQVIIACKDIYRKDQQG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG-AVFFGESMFSHMENASKI 124
           TWI   I +AY  L+ +G A ++E WK D LVGGLYGV +G  +F GESMF+   NASK+
Sbjct: 108 TWITQEIIEAYTRLYELGLARSVEVWKDDQLVGGLYGVDIGNGIFCGESMFTKSSNASKV 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               L++ LK++ +LLLD Q   +HL   GA EI   ++ ++L
Sbjct: 168 AFYTLLQELKEKNYLLLDCQVYNDHLASLGAFEIPRAEFMQIL 210


>gi|254490546|ref|ZP_05103732.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylophaga
           thiooxidans DMS010]
 gi|224464290|gb|EEF80553.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylophaga
           thiooxydans DMS010]
          Length = 241

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 98/169 (57%), Gaps = 6/169 (3%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N  D I W  P  R ++  +     K L K +R++ + +  + AFE V+ AC+     +P
Sbjct: 50  NKNDPILWWCPDPRMVLFTDEVRISKSLNKKLRKKTFTVTFDQAFEEVMQACSAPRANQP 109

Query: 65  T-----TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           T     TWI+  + +AY +L  +GYAH++E W+++ LVGGLYGV++G  FFGESMFS + 
Sbjct: 110 TDPDNRTWIHDDMIEAYKELHRLGYAHSVECWQQNKLVGGLYGVAIGKAFFGESMFSFVT 169

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           ++SK+ L  L + L +    L+D Q  ++HL   GA EI    + + L+
Sbjct: 170 DSSKVALVTLCQQLHRWGVPLIDCQIYSDHLSSMGAAEIPRALFIEHLQ 218


>gi|16128852|ref|NP_415405.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24112260|ref|NP_706770.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella flexneri 2a
           str. 301]
 gi|30062372|ref|NP_836543.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella flexneri 2a
           str. 2457T]
 gi|82543371|ref|YP_407318.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella boydii
           Sb227]
 gi|89107735|ref|AP_001515.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli str.
           K-12 substr. W3110]
 gi|157157751|ref|YP_001462081.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E24377A]
 gi|157160407|ref|YP_001457725.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli HS]
 gi|170020713|ref|YP_001725667.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           ATCC 8739]
 gi|170080543|ref|YP_001729863.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170684216|ref|YP_001744286.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           SMS-3-5]
 gi|187733750|ref|YP_001880918.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella boydii CDC
           3083-94]
 gi|188494772|ref|ZP_03002042.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           53638]
 gi|191167615|ref|ZP_03029426.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           B7A]
 gi|193071801|ref|ZP_03052693.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E110019]
 gi|194428376|ref|ZP_03060917.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           B171]
 gi|194438738|ref|ZP_03070825.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           101-1]
 gi|209918134|ref|YP_002292218.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           SE11]
 gi|218553471|ref|YP_002386384.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           IAI1]
 gi|218694358|ref|YP_002402025.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           55989]
 gi|218704314|ref|YP_002411833.1| leucyl/phenylalanyl-tRNA --protein transferase [Escherichia coli
           UMN026]
 gi|238900143|ref|YP_002925939.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           BW2952]
 gi|253774086|ref|YP_003036917.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160999|ref|YP_003044107.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli B
           str. REL606]
 gi|256020987|ref|ZP_05434852.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella sp. D9]
 gi|256023414|ref|ZP_05437279.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia sp.
           4_1_40B]
 gi|260854176|ref|YP_003228067.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O26:H11 str. 11368]
 gi|260867057|ref|YP_003233459.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O111:H- str. 11128]
 gi|293404192|ref|ZP_06648186.1| aat [Escherichia coli FVEC1412]
 gi|293409263|ref|ZP_06652839.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           B354]
 gi|293414167|ref|ZP_06656816.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           B185]
 gi|293433182|ref|ZP_06661610.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           B088]
 gi|298379973|ref|ZP_06989578.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           FVEC1302]
 gi|300817014|ref|ZP_07097233.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           107-1]
 gi|300823623|ref|ZP_07103750.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           119-7]
 gi|300899539|ref|ZP_07117779.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           198-1]
 gi|300902960|ref|ZP_07120904.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           84-1]
 gi|300921083|ref|ZP_07137467.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           115-1]
 gi|300926522|ref|ZP_07142311.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           182-1]
 gi|300929577|ref|ZP_07145040.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           187-1]
 gi|300949756|ref|ZP_07163733.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           116-1]
 gi|300954707|ref|ZP_07167142.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           175-1]
 gi|301022868|ref|ZP_07186701.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           69-1]
 gi|301024398|ref|ZP_07188085.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           196-1]
 gi|301305341|ref|ZP_07211436.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           124-1]
 gi|301325793|ref|ZP_07219241.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           78-1]
 gi|301646329|ref|ZP_07246217.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           146-1]
 gi|307137513|ref|ZP_07496869.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           H736]
 gi|307311728|ref|ZP_07591368.1| leucyl/phenylalanyl-tRNA/protein transferase [Escherichia coli W]
 gi|309795308|ref|ZP_07689726.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           145-7]
 gi|312971011|ref|ZP_07785190.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           1827-70]
 gi|331641406|ref|ZP_08342541.1| leucyltransferase [Escherichia coli H736]
 gi|331651904|ref|ZP_08352923.1| leucyltransferase [Escherichia coli M718]
 gi|331662298|ref|ZP_08363221.1| leucyltransferase [Escherichia coli TA143]
 gi|331667258|ref|ZP_08368123.1| leucyltransferase [Escherichia coli TA271]
 gi|331672426|ref|ZP_08373216.1| leucyltransferase [Escherichia coli TA280]
 gi|331676672|ref|ZP_08377368.1| leucyltransferase [Escherichia coli H591]
 gi|331682394|ref|ZP_08383013.1| leucyltransferase [Escherichia coli H299]
 gi|67467385|sp|P0A8P1|LFTR_ECOLI RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|67467386|sp|P0A8P2|LFTR_SHIFL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|119367725|sp|Q323L8|LFTR_SHIBS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166990805|sp|A7ZJV2|LFTR_ECO24 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166990806|sp|A7ZYI8|LFTR_ECOHS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|189046554|sp|B1IWN8|LFTR_ECOLC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737692|sp|B7M813|LFTR_ECO8A RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737693|sp|B1X825|LFTR_ECODH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737694|sp|B7NAN6|LFTR_ECOLU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737695|sp|B6I8V6|LFTR_ECOSE RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737696|sp|B1LJX9|LFTR_ECOSM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737725|sp|B2TUJ4|LFTR_SHIB3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|254809118|sp|B7LD77|LFTR_ECO55 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|259494486|sp|C4ZQ11|LFTR_ECOBW RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|145166|gb|AAA03231.1| Leu/Phe-tRNA-protein transferase [Escherichia coli]
 gi|146481|gb|AAC36910.1| orf 2 [Escherichia coli]
 gi|1787111|gb|AAC73971.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24051111|gb|AAN42477.1| leucyl, phenylalanyl-tRNA-protein transferase [Shigella flexneri 2a
           str. 301]
 gi|30040618|gb|AAP16349.1| leucyl, phenylalanyl-tRNA-protein transferase [Shigella flexneri 2a
           str. 2457T]
 gi|81244782|gb|ABB65490.1| leucyl, phenylalanyl-tRNA-protein transferase [Shigella boydii
           Sb227]
 gi|85674785|dbj|BAA35605.2| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli str.
           K12 substr. W3110]
 gi|157066087|gb|ABV05342.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli HS]
 gi|157079781|gb|ABV19489.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E24377A]
 gi|169755641|gb|ACA78340.1| Leucyltransferase [Escherichia coli ATCC 8739]
 gi|169888378|gb|ACB02085.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170521934|gb|ACB20112.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           SMS-3-5]
 gi|187430742|gb|ACD10016.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella boydii CDC
           3083-94]
 gi|188489971|gb|EDU65074.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           53638]
 gi|190902376|gb|EDV62114.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           B7A]
 gi|192954885|gb|EDV85396.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E110019]
 gi|194413591|gb|EDX29872.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           B171]
 gi|194422370|gb|EDX38370.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           101-1]
 gi|209911393|dbj|BAG76467.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           SE11]
 gi|218351090|emb|CAU96794.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           55989]
 gi|218360239|emb|CAQ97789.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           IAI1]
 gi|218431411|emb|CAR12289.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           UMN026]
 gi|238861642|gb|ACR63640.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           BW2952]
 gi|242376700|emb|CAQ31413.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli
           BL21(DE3)]
 gi|253325130|gb|ACT29732.1| leucyl/phenylalanyl-tRNA/protein transferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972900|gb|ACT38571.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli B
           str. REL606]
 gi|253977114|gb|ACT42784.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           BL21(DE3)]
 gi|257752825|dbj|BAI24327.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O26:H11 str. 11368]
 gi|257763413|dbj|BAI34908.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O111:H- str. 11128]
 gi|260449969|gb|ACX40391.1| leucyl/phenylalanyl-tRNA/protein transferase [Escherichia coli DH1]
 gi|281600213|gb|ADA73197.1| Leucyl/phenylalanyl-tRNA--protein transferase [Shigella flexneri
           2002017]
 gi|291324001|gb|EFE63423.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           B088]
 gi|291428778|gb|EFF01803.1| aat [Escherichia coli FVEC1412]
 gi|291434225|gb|EFF07198.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           B185]
 gi|291469731|gb|EFF12215.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           B354]
 gi|298279671|gb|EFI21179.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           FVEC1302]
 gi|299880405|gb|EFI88616.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           196-1]
 gi|300318318|gb|EFJ68102.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           175-1]
 gi|300356900|gb|EFJ72770.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           198-1]
 gi|300397330|gb|EFJ80868.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           69-1]
 gi|300405021|gb|EFJ88559.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           84-1]
 gi|300411934|gb|EFJ95244.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           115-1]
 gi|300417439|gb|EFK00750.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           182-1]
 gi|300450870|gb|EFK14490.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           116-1]
 gi|300462465|gb|EFK25958.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           187-1]
 gi|300523823|gb|EFK44892.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           119-7]
 gi|300530366|gb|EFK51428.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           107-1]
 gi|300839359|gb|EFK67119.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           124-1]
 gi|300847436|gb|EFK75196.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           78-1]
 gi|301075432|gb|EFK90238.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           146-1]
 gi|306908283|gb|EFN38782.1| leucyl/phenylalanyl-tRNA/protein transferase [Escherichia coli W]
 gi|308120958|gb|EFO58220.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           145-7]
 gi|310336772|gb|EFQ01939.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           1827-70]
 gi|313650203|gb|EFS14615.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella flexneri 2a
           str. 2457T]
 gi|315060170|gb|ADT74497.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli W]
 gi|315135533|dbj|BAJ42692.1| aat [Escherichia coli DH1]
 gi|315257923|gb|EFU37891.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           85-1]
 gi|315619196|gb|EFU99775.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           3431]
 gi|320180602|gb|EFW55531.1| Leucyl/phenylalanyl-tRNA--protein transferase [Shigella boydii ATCC
           9905]
 gi|320183177|gb|EFW58035.1| Leucyl/phenylalanyl-tRNA--protein transferase [Shigella flexneri
           CDC 796-83]
 gi|320202279|gb|EFW76850.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           EC4100B]
 gi|323155742|gb|EFZ41911.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           EPECa14]
 gi|323159509|gb|EFZ45489.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E128010]
 gi|323172145|gb|EFZ57783.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           LT-68]
 gi|323175494|gb|EFZ61089.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           1180]
 gi|323185151|gb|EFZ70516.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           1357]
 gi|323379273|gb|ADX51541.1| leucyl/phenylalanyl-tRNA/protein transferase [Escherichia coli
           KO11]
 gi|323942801|gb|EGB38966.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           E482]
 gi|323947183|gb|EGB43192.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           H120]
 gi|323962933|gb|EGB58506.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           H489]
 gi|324019025|gb|EGB88244.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           117-3]
 gi|324116098|gb|EGC10022.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           E1167]
 gi|331038204|gb|EGI10424.1| leucyltransferase [Escherichia coli H736]
 gi|331050182|gb|EGI22240.1| leucyltransferase [Escherichia coli M718]
 gi|331060720|gb|EGI32684.1| leucyltransferase [Escherichia coli TA143]
 gi|331065614|gb|EGI37507.1| leucyltransferase [Escherichia coli TA271]
 gi|331070332|gb|EGI41697.1| leucyltransferase [Escherichia coli TA280]
 gi|331075361|gb|EGI46659.1| leucyltransferase [Escherichia coli H591]
 gi|331080025|gb|EGI51204.1| leucyltransferase [Escherichia coli H299]
 gi|332097121|gb|EGJ02104.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella boydii
           3594-74]
 gi|332104565|gb|EGJ07911.1| leucyl/phenylalanyl-tRNA-protein transferase [Shigella sp. D9]
          Length = 234

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|56413993|ref|YP_151068.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362916|ref|YP_002142553.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|81599475|sp|Q5PGJ6|LFTR_SALPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737721|sp|B5BBS0|LFTR_SALPK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|56128250|gb|AAV77756.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094393|emb|CAR59908.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 234

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAGLRQQP 218


>gi|15830224|ref|NP_308997.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. Sakai]
 gi|168783795|ref|ZP_02808802.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4076]
 gi|168789220|ref|ZP_02814227.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC869]
 gi|195939548|ref|ZP_03084930.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4024]
 gi|208806449|ref|ZP_03248786.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4206]
 gi|208816277|ref|ZP_03257456.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4045]
 gi|208822451|ref|ZP_03262770.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4042]
 gi|209399489|ref|YP_002269558.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4115]
 gi|217324876|ref|ZP_03440960.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. TW14588]
 gi|254792085|ref|YP_003076922.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227390|ref|ZP_05941671.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256187|ref|ZP_05948720.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281888|ref|YP_003498706.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O55:H7 str. CB9615]
 gi|33301306|sp|Q8X5I5|LFTR_ECO57 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226736125|sp|B5YT20|LFTR_ECO5E RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|13360429|dbj|BAB34393.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli
           O157:H7 str. Sakai]
 gi|188998914|gb|EDU67900.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4076]
 gi|189371162|gb|EDU89578.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC869]
 gi|208726250|gb|EDZ75851.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4206]
 gi|208732925|gb|EDZ81613.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4045]
 gi|208737936|gb|EDZ85619.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160889|gb|ACI38322.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC4115]
 gi|209775098|gb|ACI85861.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli]
 gi|209775100|gb|ACI85862.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli]
 gi|209775102|gb|ACI85863.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli]
 gi|209775104|gb|ACI85864.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli]
 gi|209775106|gb|ACI85865.1| leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli]
 gi|217321097|gb|EEC29521.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. TW14588]
 gi|254591485|gb|ACT70846.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O157:H7 str. TW14359]
 gi|290761761|gb|ADD55722.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O55:H7 str. CB9615]
 gi|320192629|gb|EFW67270.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. EC1212]
 gi|320637755|gb|EFX07547.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. G5101]
 gi|320642879|gb|EFX12080.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H- str. 493-89]
 gi|320648336|gb|EFX16991.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H- str. H 2687]
 gi|320654174|gb|EFX22242.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320659798|gb|EFX27354.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320664267|gb|EFX31418.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326338220|gb|EGD62049.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. 1125]
 gi|326346197|gb|EGD69935.1| Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 str. 1044]
          Length = 234

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 87/161 (54%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
              I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   T
Sbjct: 53  GDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L
Sbjct: 111 WITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +        L+D Q + +H    GA EI    Y   L
Sbjct: 171 LVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRNYLNYL 211


>gi|284920738|emb|CBG33801.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli 042]
          Length = 234

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFLGHGGKLIDCQVLNDHTASLGAFEIPRRDYLNYL 211


>gi|256425534|ref|YP_003126187.1| leucyl/phenylalanyl-tRNA/protein transferase [Chitinophaga pinensis
           DSM 2588]
 gi|256040442|gb|ACU63986.1| leucyl/phenylalanyl-tRNA/protein transferase [Chitinophaga pinensis
           DSM 2588]
          Length = 214

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RP 64
           +   I W  P  R ++  E       +K+ +++ ++ I +N  F +VI+ C +  ++ + 
Sbjct: 48  DEPPILWWSPDPRFVLFPEDLKISASMKQVLKKGIFTITVNKDFPAVIAGCRKVPRRGQD 107

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++KAYI L   GYAH++E W+ D LVGG YG+ LG  FFGESMFS + NASK 
Sbjct: 108 GTWITRDVEKAYISLHKAGYAHSVECWQNDQLVGGFYGIQLGTSFFGESMFSLVSNASKA 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
                V++   +   L+D Q  T+HL   GA  I   ++ +++ N
Sbjct: 168 AFITFVQYAAGKGITLIDCQVYTDHLASLGAGMIPREEFLRIIRN 212


>gi|16759826|ref|NP_455443.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16764316|ref|NP_459931.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29142401|ref|NP_805743.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|62179479|ref|YP_215896.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|167550373|ref|ZP_02344130.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167995286|ref|ZP_02576376.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168240805|ref|ZP_02665737.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168466539|ref|ZP_02700401.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168822945|ref|ZP_02834945.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194447544|ref|YP_002044948.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197249422|ref|YP_002145873.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|213649844|ref|ZP_03379897.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213865547|ref|ZP_03387666.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224582765|ref|YP_002636563.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|289830109|ref|ZP_06547540.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|54037736|sp|P67614|LFTR_SALTI RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|54041560|sp|P67613|LFTR_SALTY RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|75484260|sp|Q57R46|LFTR_SALCH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737715|sp|B5F138|LFTR_SALA4 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737719|sp|B4TD16|LFTR_SALHS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|254809175|sp|C0PXS2|LFTR_SALPC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|25350298|pir||AI0610 leucyl/phenylalanyl-tRNA-protein transferase [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16419466|gb|AAL19890.1| leucyl, phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16502119|emb|CAD05355.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138031|gb|AAO69592.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|62127112|gb|AAX64815.1| leucyl, phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|194405848|gb|ACF66067.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|195631063|gb|EDX49649.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197213125|gb|ACH50522.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|205324611|gb|EDZ12450.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327012|gb|EDZ13776.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205339830|gb|EDZ26594.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205340752|gb|EDZ27516.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|224467292|gb|ACN45122.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261246172|emb|CBG23976.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267992686|gb|ACY87571.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157499|emb|CBW16989.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911943|dbj|BAJ35917.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320085190|emb|CBY94976.1| leucyl, phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321223278|gb|EFX48347.1| Leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322713948|gb|EFZ05519.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323129221|gb|ADX16651.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
          Length = 234

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQP 218


>gi|123441832|ref|YP_001005816.1| leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|158512681|sp|A1JMD2|LFTR_YERE8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|122088793|emb|CAL11599.1| putative leucyl/phenylalanyl-tRNA-protein transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 236

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 86/149 (57%), Gaps = 2/149 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E  H  + +++++R   Y   +N AF+ VI ACA  T +   TWI 
Sbjct: 56  ILWWSPDPRAVLYPEDLHISRSMRRFLRNCPYRFTLNHAFKDVIRACA--TLRDEGTWIG 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q+AY  L  +G+AH++E W ++ LVGGLYG+S+G++F GESMFS   NASK  L   
Sbjct: 114 DDVQQAYCHLHTLGHAHSVEVWLENELVGGLYGISVGSLFCGESMFSRANNASKSALMVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  +    L+D Q +  H    GAIEI
Sbjct: 174 CHHFTRHGGELIDCQVLNAHTASLGAIEI 202


>gi|122919950|pdb|2DPS|A Chain A, Structure Of LeucylPHENYLALANYL-Trna-Protein Transferase
 gi|122919951|pdb|2DPS|B Chain B, Structure Of LeucylPHENYLALANYL-Trna-Protein Transferase
 gi|122919952|pdb|2DPT|A Chain A, LeucylPHENYLALANYL-Trna-Protein Transferase Complexed With
           Puromycin
 gi|122919953|pdb|2DPT|B Chain B, LeucylPHENYLALANYL-Trna-Protein Transferase Complexed With
           Puromycin
          Length = 254

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 71  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 128

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 129 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 188

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 189 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 231


>gi|52841995|ref|YP_095794.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148359312|ref|YP_001250519.1| leucyl/phenylalanyl-tRNA protein transferase [Legionella
           pneumophila str. Corby]
 gi|296107359|ref|YP_003619059.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|61213320|sp|Q5ZUM5|LFTR_LEGPH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|166224665|sp|A5ICS3|LFTR_LEGPC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|52629106|gb|AAU27847.1| leucyl/phenylalanyl-tRNA protein transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148281085|gb|ABQ55173.1| leucyl/phenylalanyl-tRNA protein transferase [Legionella
           pneumophila str. Corby]
 gi|295649260|gb|ADG25107.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610468|emb|CBX00039.1| hypothetical protein LPW_17951 [Legionella pneumophila 130b]
          Length = 222

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 1/164 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R I+    F   + LKK +++  + + ++TAF+ VIS CA  + +   TWI   
Sbjct: 52  WWSPNPRLILIPNEFKISRSLKKTLKKP-FKLTVDTAFQRVISYCATCSDRSNKTWITSE 110

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           + + Y  L  MGYAH+ E W    LVGGLYG+SLG  FFGESMF  + +ASK+ L  L +
Sbjct: 111 MIETYTQLHEMGYAHSFEIWDGSELVGGLYGISLGHAFFGESMFHTITDASKVALHFLCR 170

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
            ++   F  +D Q  T HL   GA  I+  ++  +L+  LK+P+
Sbjct: 171 IMQSWNFDFIDCQLPTLHLMSLGAKIISRKEFLHMLQETLKYPD 214


>gi|326794634|ref|YP_004312454.1| leucyl/phenylalanyl-tRNA--protein transferase [Marinomonas
           mediterranea MMB-1]
 gi|326545398|gb|ADZ90618.1| Leucyl/phenylalanyl-tRNA--protein transferase [Marinomonas
           mediterranea MMB-1]
          Length = 248

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 88/170 (51%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++   I W  P +R  +  E FHT + LKK IR   +   +N  F++VI  CA    +  
Sbjct: 59  SDPDPILWWHPPQRCCLYPEEFHTSRSLKKAIRHADWRWSVNGDFDTVIDHCASLRARNE 118

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  I+ AY +L    YA + E W  D L GG YGV+LG VFFGESMFS   NASK+
Sbjct: 119 GTWISEDIKSAYTNLNKNNYAFSFEVWLDDELAGGFYGVALGNVFFGESMFSLKPNASKV 178

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L    +  K     L+D Q  + HL   GA  +   Q+   L + +K P
Sbjct: 179 ALKLFSEKCKDWGIKLIDCQVESEHLLSLGACNLPREQFIPTLASFVKTP 228


>gi|302339652|ref|YP_003804858.1| leucyl/phenylalanyl-tRNA/protein transferase [Spirochaeta
           smaragdinae DSM 11293]
 gi|301636837|gb|ADK82264.1| leucyl/phenylalanyl-tRNA/protein transferase [Spirochaeta
           smaragdinae DSM 11293]
          Length = 222

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 95/164 (57%), Gaps = 1/164 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
            +   I W  P  R ++  E  H+  RL++ IR   Y + ++ AF+ VI +C++  +  +
Sbjct: 47  GDDSPILWWNPHPRFVLFPEKLHSSHRLERRIRSGEYRVTMDRAFDQVIRSCSEVPRPGQ 106

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +  AY  L  +GYAH+ E+W +  LVGGLYGVS+GA+F GESMF+   +ASK
Sbjct: 107 EGTWITEEMITAYQRLHSLGYAHSFESWFEGQLVGGLYGVSVGALFCGESMFALRRDASK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           +     V+ L ++ + L+D Q  T HL  FGA EI+   +  LL
Sbjct: 167 VAFVTAVRFLVRQNYRLIDCQVYTEHLASFGAEEISREHFLSLL 210


>gi|323526237|ref|YP_004228390.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           CCGE1001]
 gi|323383239|gb|ADX55330.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           CCGE1001]
          Length = 245

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 99/179 (55%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F     L+K ++R L D    IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLKRVLCDDAWEIRVDHDFGAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   +  AY  L   G AH+IE W +   VGGLYGVS G +FFGESMF+++ 
Sbjct: 112 RRGQRGTWITADVVDAYTSLHRAGDAHSIETWFEGERVGGLYGVSFGKMFFGESMFANVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASK+ L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  ++  P I +
Sbjct: 172 DASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVDAPRIPW 230


>gi|159795696|pdb|2Z3L|A Chain A, Complex Structure Of Lf-Transferase And Peptide A
 gi|159795697|pdb|2Z3L|B Chain B, Complex Structure Of Lf-Transferase And Peptide A
 gi|159795702|pdb|2Z3N|A Chain A, Complex Structure Of Lf-Transferase And Peptide B
 gi|159795703|pdb|2Z3N|B Chain B, Complex Structure Of Lf-Transferase And Peptide B
 gi|253722602|pdb|2Z3K|A Chain A, Complex Structure Of Lf-Transferase And Raf
 gi|253722603|pdb|2Z3K|B Chain B, Complex Structure Of Lf-Transferase And Raf
 gi|253722604|pdb|2Z3M|A Chain A, Complex Structure Of Lf-Transferase And Daf
 gi|253722605|pdb|2Z3M|B Chain B, Complex Structure Of Lf-Transferase And Daf
 gi|253722606|pdb|2Z3O|A Chain A, Complex Structure Of Lf-Transferase And Phenylalanine
 gi|253722607|pdb|2Z3O|B Chain B, Complex Structure Of Lf-Transferase And Phenylalanine
 gi|253722608|pdb|2Z3P|A Chain A, Complex Structure Of Lf-Transferase And Leucine
 gi|253722609|pdb|2Z3P|B Chain B, Complex Structure Of Lf-Transferase And Leucine
          Length = 233

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 50  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 107

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 108 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 168 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 210


>gi|213052420|ref|ZP_03345298.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
          Length = 245

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQP 218


>gi|160888886|ref|ZP_02069889.1| hypothetical protein BACUNI_01306 [Bacteroides uniformis ATCC 8492]
 gi|156861785|gb|EDO55216.1| hypothetical protein BACUNI_01306 [Bacteroides uniformis ATCC 8492]
          Length = 216

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 93/163 (57%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P+ R +I  +  H    ++  I +  Y+I  N AF+ +I  C +   ++   W+ 
Sbjct: 53  IQWWCPMDRFVIFPDEIHISHSMRTLINKGKYEITFNEAFQDIIQTCGELRIEQEGAWLG 112

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L   G+A ++E W+++ LVGGLYGV+LG  FFGESMFS + +ASK+ L HL
Sbjct: 113 TKMMEAYTHLHEQGFAASVEVWEEEQLVGGLYGVTLGRCFFGESMFSLVPSASKLALIHL 172

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            +  ++   +++D QF T HL+  G   I++ +Y   +E   +
Sbjct: 173 AQFFREHGGVMIDCQFETPHLKTMGGRHISYDEYMTYIEQDCR 215


>gi|331646152|ref|ZP_08347255.1| leucyltransferase [Escherichia coli M605]
 gi|330910666|gb|EGH39176.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           AA86]
 gi|331044904|gb|EGI17031.1| leucyltransferase [Escherichia coli M605]
          Length = 234

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTLNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RDVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                     L+D Q + +H    GA EI    Y   L
Sbjct: 174 CDEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|320539587|ref|ZP_08039252.1| leucyl/phenylalanyl-tRNA-protein transferase [Serratia symbiotica
           str. Tucson]
 gi|320030346|gb|EFW12360.1| leucyl/phenylalanyl-tRNA-protein transferase [Serratia symbiotica
           str. Tucson]
          Length = 234

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 90/159 (56%), Gaps = 2/159 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R ++     H  + LK+++R   + I +N  F +VI+ACA +  +  
Sbjct: 51  SPGKAILWWSPDPRAVLFPAERHLSRSLKRFLRSNPFCITLNHDFAAVIAACAHRPHE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            +WI   +  AY+ L  +GYAH++E W++  LVGG+YGV+ GA+F GESMFSH+ NASK 
Sbjct: 109 GSWIGPEMLHAYLQLHLLGYAHSVEVWQQGQLVGGMYGVAQGALFCGESMFSHVSNASKC 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            L    +H       L+D Q +  H  Q GA EI   ++
Sbjct: 169 ALMAFCRHFAAYGGELIDCQVLNAHSAQLGAREIPRPRH 207


>gi|78485458|ref|YP_391383.1| leucyl/phenylalanyl-tRNA--protein transferase [Thiomicrospira
           crunogena XCL-2]
 gi|119368215|sp|Q31GL4|LFTR_THICR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|78363744|gb|ABB41709.1| leucyl/phenylalanyl-tRNA--protein transferase [Thiomicrospira
           crunogena XCL-2]
          Length = 256

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 95/166 (57%), Gaps = 2/166 (1%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           N  D I W  P  R ++ + +    + L K IR++ + + ++  FE V+  CA  +   +
Sbjct: 56  NEDDPILWWTPNPRSVLFINSLKVRRSLIKTIRKQQFTVTLDQQFEDVMHQCANIERHDQ 115

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  +  AY  L   G+AH++E WK + LVGGLYGV++G VFFGESMFS + +ASK
Sbjct: 116 DGTWISEEMLSAYTQLHKSGHAHSVEVWKDNQLVGGLYGVAIGKVFFGESMFSKVPDASK 175

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           I L  L + LK   F ++D Q  T HLR  GA  I+   +  +L+ 
Sbjct: 176 IALVALCQQLKAWGFRIIDTQMETAHLRSLGATLISREYFESILKQ 221


>gi|315179864|gb|ADT86778.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio furnissii
           NCTC 11218]
          Length = 242

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 87/161 (54%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K +KK+ R+  Y + IN A   VI  CA   +    T
Sbjct: 55  GEPILWWSPSPRAVFDPKTFKPAKSVKKFQRKHQYTVSINHATTDVIEMCA-AVRSPQET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +++AY  L   G  H++E W+ D LVGGLYG+ +G +F GESMFS   NASKI L
Sbjct: 114 WLNEPMRQAYGQLAREGKCHSVEVWQHDTLVGGLYGIEVGQLFCGESMFSTATNASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +   H    Q  L+D Q +  HL+  GA E++   + + L
Sbjct: 174 WYFCNHFSTHQGKLIDCQVMNPHLKSLGAKELSRDNFMQSL 214


>gi|325285909|ref|YP_004261699.1| Leucyl/phenylalanyl-tRNA--protein transferase [Cellulophaga lytica
           DSM 7489]
 gi|324321363|gb|ADY28828.1| Leucyl/phenylalanyl-tRNA--protein transferase [Cellulophaga lytica
           DSM 7489]
          Length = 214

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 86/158 (54%), Gaps = 1/158 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINM 70
           W  P  R ++  +     K ++K +R E + +  N  FE VI  CA   +  +P TWI  
Sbjct: 57  WWSPDPRMVLFPQELKVSKSMRKLLRDETFTVTKNKNFEEVIHRCATVPRDGQPGTWITQ 116

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLV 130
            +Q AYI+L   G+AH+ E W    LVGGLYG+ LG VF GESMFS + NASK     +V
Sbjct: 117 NMQNAYIELHKKGFAHSYEVWLDSQLVGGLYGIDLGTVFCGESMFSDVSNASKYGFITMV 176

Query: 131 KHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           + ++   + L+D Q  T HL   GA EI    + + +E
Sbjct: 177 QEMQANNYKLIDCQVYTQHLESLGAREIDRGYFMEFIE 214


>gi|299771303|ref|YP_003733329.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter sp.
           DR1]
 gi|298701391|gb|ADI91956.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter sp.
           DR1]
          Length = 243

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 96/172 (55%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +I  + +   K L + +++  Y I +N AFE VI +C+        T
Sbjct: 51  DEPICWWSPEPRCVIYPQNYKPSKSLLRNMKKHDYTITVNHAFEEVIRSCSLPRSYADET 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI+  I + Y ++F  GY +++E W ++ LVGGLYG+++G   FGESMFS+  + SK+  
Sbjct: 111 WISEDIIQGYCEMFNAGYGYSVEVWDQNELVGGLYGITIGKGCFGESMFSNETDVSKMAF 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
             L+   ++ Q   +D Q + +HL   GA  ++   Y K L++ + HP I++
Sbjct: 171 YTLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQDYLKSLQDVIIHPSINW 222


>gi|294672829|ref|YP_003573445.1| leucyltransferase [Prevotella ruminicola 23]
 gi|294474206|gb|ADE83595.1| leucyltransferase [Prevotella ruminicola 23]
          Length = 216

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 92/164 (56%), Gaps = 2/164 (1%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACA--QKTQKRPT 65
           Q+  W  PL+R +I     H    +++ IR+    I IN  FE VI  CA  Q       
Sbjct: 53  QEPLWYCPLQRFVIFPNEVHISHSMQQVIRKGELQITINQDFEGVIRGCATAQNRNNDEG 112

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
            W+   + +AY ++   G+A ++E W+ + LVGGLYG++LG  FFGESMFS + NASK+ 
Sbjct: 113 AWLGPEMIEAYTEMHRQGFAASVEVWQGETLVGGLYGINLGTAFFGESMFSLVPNASKLA 172

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           L HL +   K    L+D QF T HL++ G   I +  Y +LL++
Sbjct: 173 LIHLAQTFDKLGGKLIDCQFETPHLKRMGGRFIPYETYIRLLKS 216


>gi|325121200|gb|ADY80723.1| leucyl, phenylalanyl-tRNA-protein transferase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 243

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 97/171 (56%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R +I  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCVIYPQNYKPSKSLLRNMKKHDYAITVNHAFEQVIRSCSLPRSYADETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y ++F  GY +++E W+++ LVGGLYGV++G   FGESMFS+  + SK+   
Sbjct: 112 ISEDIIQGYCEMFKAGYGYSVEVWQQEELVGGLYGVTIGKGCFGESMFSNETDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++   Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWIDCQLVNSHLISLGASTLSRQDYLKSLQDVIIHPSINW 222


>gi|254480475|ref|ZP_05093722.1| leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2148]
 gi|214039058|gb|EEB79718.1| leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2148]
          Length = 237

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 96/168 (57%), Gaps = 1/168 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q + W  P  R ++  E  H  + L K +RR+   + +++ FE V+  CAQ       
Sbjct: 52  EPQPVLWWTPDPRSVLFPEKLHISRSLHKTLRRDRLQLAVDSRFEQVMRHCAQLRGDGLG 111

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASKI 124
           TWI   +  AY DL ++G+AH++E    D  LVGGLYG+++G  FFGESMFS +++ASK+
Sbjct: 112 TWIGDDMLAAYCDLHHIGHAHSVEVLDVDGQLVGGLYGIAVGRAFFGESMFSEVQDASKV 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
            L  L+  L++  F L+D Q  + HL   GA  I+ + + ++L + + 
Sbjct: 172 ALVALLNILERGGFKLIDCQVESEHLNSLGAENISRLDFERMLAHTID 219


>gi|295676374|ref|YP_003604898.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           CCGE1002]
 gi|295436217|gb|ADG15387.1| leucyl/phenylalanyl-tRNA/protein transferase [Burkholderia sp.
           CCGE1002]
          Length = 245

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 103/179 (57%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGII-PLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+ P E   +P   K LK+ +R + ++IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILRPAEFKLSPSLRKTLKRMLRDDAWEIRVDQDFAAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   + +AY  L  +G AH+IE W +   V GLYGVSLG +FFGESM++ + 
Sbjct: 112 RRGQRGTWITADVVEAYSSLHRLGDAHSIETWFEGKRVAGLYGVSLGRMFFGESMYTDVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           + SK+ L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  ++  P I +
Sbjct: 172 DGSKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFVAHVRASVGAPAIPW 230


>gi|330429185|gb|AEC20519.1| leucyl/phenylalanyl-tRNA--protein transferase [Pusillimonas sp.
           T7-7]
          Length = 250

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (54%), Gaps = 9/174 (5%)

Query: 10  ISWIKPLRRGIIPLETFHTP----KRLKKYIRRELYD---IRINT--AFESVISACAQKT 60
           I W  P  R ++  + F T     K+L++  R E  D   IR++T  AF ++I  CA+  
Sbjct: 54  ILWWSPDPRMVLTCDEFKTSHSLSKKLRQIARNEGTDSVRIRVSTNLAFAAIIRGCAEPR 113

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             +  TWI+ +IQ AY      G AH+IE W    L GGLYGV LG  FFGESMFS   +
Sbjct: 114 GMQHATWISPSIQAAYTAWHKAGAAHSIETWIDGELAGGLYGVCLGRFFFGESMFSRATD 173

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASKI L +L++ L  R    +D Q  T HL   GA  ++  Q+  LL  AL++P
Sbjct: 174 ASKIALAYLIRFLSIRGISHIDCQQQTGHLATLGARPLSRKQFLDLLNKALQYP 227


>gi|290473954|ref|YP_003466828.1| leucyl, phenylalanyl-tRNA-protein transferase [Xenorhabdus bovienii
           SS-2004]
 gi|289173261|emb|CBJ80036.1| leucyl, phenylalanyl-tRNA-protein transferase [Xenorhabdus bovienii
           SS-2004]
          Length = 229

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 85/156 (54%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++     HT + L+++IR+  Y I +N AF+ VI  CAQ+ +    TWI   
Sbjct: 57  WWSPDPRAVLIPGELHTGRTLRRFIRKLPYQITVNYAFDQVIYGCAQRQEG---TWIGSD 113

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +QK Y  L   G AH+IE W    LVGGLYG+++G +F GESMFS MENASK        
Sbjct: 114 VQKGYQALHQEGLAHSIEVWHDCQLVGGLYGINVGTLFCGESMFSKMENASKCAFVAFYH 173

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H       LLD Q + +H +  GA  I   ++ + L
Sbjct: 174 HFLHHGGQLLDCQVLNHHTKSLGAKNIPRKEFLQHL 209


>gi|302671434|ref|YP_003831394.1| leucyl/phenylalanyl-tRNA-protein transferase Aat [Butyrivibrio
           proteoclasticus B316]
 gi|302395907|gb|ADL34812.1| leucyl/phenylalanyl-tRNA-protein transferase Aat [Butyrivibrio
           proteoclasticus B316]
          Length = 215

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 88/165 (53%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            Q I W  P  R II     H    +KK++R+    + +N  F   +  C  K +    T
Sbjct: 51  GQPIMWWCPRERYIIRPGNVHISHSMKKFMRKHDIRVEVNRDFSDTMHRCRIKREFAEGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   ++ AY DL     A +++A+    L GGLYGVSLG  FFGESMFS MEN SK+ L
Sbjct: 111 WITTDMENAYADLAANNLALSVDAFIDGELAGGLYGVSLGRCFFGESMFSDMENGSKLAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
             L + L +  ++ +D QF T+HL   G   IT+ +Y +LL+  L
Sbjct: 171 IGLSQILAENGYVFIDCQFHTDHLESMGGERITYQEYKELLDQGL 215


>gi|309701161|emb|CBJ00461.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli ETEC
           H10407]
 gi|323937991|gb|EGB34253.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           E1520]
          Length = 234

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + +H    GA EI    Y   L
Sbjct: 174 CEEFIGHGGKLIDCQVLNDHTASLGACEILRRDYLNYL 211


>gi|161503919|ref|YP_001571031.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189046558|sp|A9MHZ9|LFTR_SALAR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|160865266|gb|ABX21889.1| hypothetical protein SARI_02009 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 234

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 89/173 (51%), Gaps = 2/173 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  C     +  
Sbjct: 51  SPGDPILWWSPDPRAVLWPEEFHLSRSMKRFHNTSPYRVTLNYAFDRVIDGCTNHRDE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK 
Sbjct: 109 GTWITRGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRKENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
            L             L+D Q + +H    GAIEI    Y + L    + P +S
Sbjct: 169 ALLVFCAEFIHHGGKLIDCQVLNSHTASLGAIEIPRCDYLEHLSRLRQQPLVS 221


>gi|146307413|ref|YP_001187878.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudomonas
           mendocina ymp]
 gi|166224668|sp|A4XUY0|LFTR_PSEMY RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|145575614|gb|ABP85146.1| Leucyltransferase [Pseudomonas mendocina ymp]
          Length = 226

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 96/169 (56%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W  P  R ++  +  H  + L K +R++ Y +  +  F +VI+ACA        
Sbjct: 51  DGQPILWWSPDPRTVLFPQELHISRSLAKLLRQQRYRVTFDQDFAAVIAACAAPRAYADG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +Q+AY  L   G AH++E W+ + LVGGLYG+++G +FFGESMFS  +NASK+ 
Sbjct: 111 TWITRGMQEAYRQLHQRGIAHSVEVWQGEQLVGGLYGLAIGQLFFGESMFSRADNASKVG 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
              LV  L++  F+L+D Q  T HL  FGA  I    +A  L+  L  P
Sbjct: 171 FATLVGKLQEWGFVLIDCQMPTQHLHSFGARAIPRATFADYLQRHLNLP 219


>gi|168230848|ref|ZP_02655906.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|194472481|ref|ZP_03078465.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194458845|gb|EDX47684.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|205334651|gb|EDZ21415.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|322616387|gb|EFY13296.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322619637|gb|EFY16512.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322622667|gb|EFY19512.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322628580|gb|EFY25367.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631516|gb|EFY28272.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637043|gb|EFY33746.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322641596|gb|EFY38233.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644449|gb|EFY40989.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649581|gb|EFY46012.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322654117|gb|EFY50440.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658032|gb|EFY54299.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663506|gb|EFY59708.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322670242|gb|EFY66382.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671478|gb|EFY67600.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676834|gb|EFY72901.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682759|gb|EFY78778.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686438|gb|EFY82420.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323196108|gb|EFZ81271.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323196746|gb|EFZ81890.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323202974|gb|EFZ88008.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209015|gb|EFZ93952.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323211920|gb|EFZ96748.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323215148|gb|EFZ99893.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323222351|gb|EGA06729.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226872|gb|EGA11055.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323229826|gb|EGA13949.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233051|gb|EGA17147.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240786|gb|EGA24828.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323243103|gb|EGA27123.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323247424|gb|EGA31380.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323251646|gb|EGA35513.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323257366|gb|EGA41064.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323261955|gb|EGA45521.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323267970|gb|EGA51449.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323271963|gb|EGA55378.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 234

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQP 218


>gi|89092937|ref|ZP_01165889.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanospirillum sp.
           MED92]
 gi|89082962|gb|EAR62182.1| leucyl/phenylalanyl-tRNA--protein transferase [Oceanospirillum sp.
           MED92]
          Length = 234

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 93/169 (55%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + + W  P  R ++  +  H  + ++K ++++ + +  +T F++VI+ACA        T
Sbjct: 52  GEPVLWWSPNPRCVVFPDQLHVSRSMRKRLKKKDFKVVFDTNFDAVINACAAPRDGADGT 111

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   ++ AY  L   G AH++E +  D LVGGLYG+++G +FFGESMFS   +ASKI  
Sbjct: 112 WITAEMKAAYNALHAAGIAHSVEVYMDDQLVGGLYGLAIGKLFFGESMFSRSRDASKIAF 171

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
             +V+ ++   + L+D Q    HL   GA EI   Q+   L   L  P+
Sbjct: 172 IKMVEQMQIWGYALIDCQVSNEHLFSLGATEIPRDQFQSYLNRYLDQPQ 220


>gi|92114555|ref|YP_574483.1| leucyl/phenylalanyl-tRNA--protein transferase [Chromohalobacter
           salexigens DSM 3043]
 gi|119367692|sp|Q1QUS4|LFTR_CHRSD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91797645|gb|ABE59784.1| Leucyltransferase [Chromohalobacter salexigens DSM 3043]
          Length = 256

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 92/175 (52%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           A  + I W  P  R ++  E  H  + L K +R   + +  + AFE+VI+ACA       
Sbjct: 50  APGEPILWWSPDPRLVLFPEEIHVRRSLAKRLRNAGFTVTFDHAFEAVITACATTRAAAE 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L   G AH++E W+   LVGGLYG++LG VFFGESMFS + +ASK+
Sbjct: 110 GTWITPAMHAAYYRLHIEGDAHSVEVWRDGELVGGLYGIALGGVFFGESMFSRVADASKV 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISFL 179
            L HL +HL      L+D Q  T HL   GA  I    +   L+  +  P  S L
Sbjct: 170 ALVHLARHLAAHGGRLIDCQVHTPHLASLGARCIARTTFIDYLDQYVSAPVSSSL 224


>gi|268607892|ref|ZP_06141623.1| leucyl/phenylalanyl-tRNA--protein transferase [Ruminococcus
           flavefaciens FD-1]
          Length = 215

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 90/166 (54%), Gaps = 1/166 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N  D I W  P  R II  E  H    +KK++++   +++++  F   I  C  K +   
Sbjct: 48  NPDDPILWWCPKERFIIRPENIHISHSMKKFMKQHKVEMKLDRDFADTIHRCRMKREATV 107

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++KAY +L   G A+++EA+    L GGLYGV +G  FFGESMFS  EN SK 
Sbjct: 108 GTWITDDMEKAYCELHKFGLANSVEAYIDGELAGGLYGVCIGRCFFGESMFSDKENGSKA 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
            L    + L +R F+++D QF T+HL   G   I   +Y +LL+  
Sbjct: 168 ALILFAQFLAERDFVMIDCQFHTDHLESMGGERINWEEYRRLLDEG 213


>gi|184157143|ref|YP_001845482.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii ACICU]
 gi|239503191|ref|ZP_04662501.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB900]
 gi|294842219|ref|ZP_06786902.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter sp.
           6014059]
 gi|183208737|gb|ACC56135.1| Leu/Phe-tRNA-protein transferase [Acinetobacter baumannii ACICU]
 gi|193076627|gb|ABO11306.2| leucyl phenylalanyl-tRNA-protein transferase [Acinetobacter
           baumannii ATCC 17978]
 gi|322507041|gb|ADX02495.1| aat [Acinetobacter baumannii 1656-2]
 gi|323516908|gb|ADX91289.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 243

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 96/171 (56%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R II  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCIIYPQNYKPSKSLIRNMKKYDYTITVNRAFEQVIRSCSLPRSYANETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  +F  GY +++E W+++ LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIEGYCGMFDAGYGYSVEVWQEEQLVGGLYGVTIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++  +Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQEYLKSLQDVIIHPSINW 222


>gi|15800748|ref|NP_286762.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           O157:H7 EDL933]
 gi|12514044|gb|AAG55372.1|AE005277_13 leucyl, phenylalanyl-tRNA-protein transferase [Escherichia coli
           O157:H7 str. EDL933]
          Length = 234

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 87/161 (54%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
              I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   T
Sbjct: 53  GDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   + +AY  L  +G+AH+IE W++B LVGG+YGV+ G +F GESMFS MENASK  L
Sbjct: 111 WITRGVVEAYHRLHELGHAHSIEVWREBELVGGMYGVAQGTLFCGESMFSRMENASKTAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +        L+D Q + +H    GA EI    Y   L
Sbjct: 171 LVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRNYLNYL 211


>gi|54297681|ref|YP_124050.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           pneumophila str. Paris]
 gi|61213300|sp|Q5X4E4|LFTR_LEGPA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|53751466|emb|CAH12884.1| hypothetical protein lpp1732 [Legionella pneumophila str. Paris]
          Length = 222

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 1/164 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R I+    F   + LKK +++  + + ++TAF+ VIS CA  + +   TWI   
Sbjct: 52  WWSPNPRLILIPNEFKISRSLKKTLKKP-FKLTVDTAFQRVISYCATCSDRTNKTWITSE 110

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           + + Y  L  MGYAH+ E W    LVGGLYG+SLG  FFGESMF  + +ASK+ L  L  
Sbjct: 111 MIETYTQLHEMGYAHSFEIWDGSELVGGLYGISLGHAFFGESMFHTITDASKVALHFLCS 170

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
            ++   F  +D Q  T HL + GA  I+  ++  +L+  LK+P+
Sbjct: 171 IMQSWNFDFIDCQLPTLHLMRLGAKIISRKEFLHMLQETLKYPD 214


>gi|169634051|ref|YP_001707787.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii SDF]
 gi|169152843|emb|CAP01872.1| leucyl, phenylalanyl-tRNA-protein transferase [Acinetobacter
           baumannii]
          Length = 243

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 96/171 (56%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R II  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWNPEPRCIIYPQNYKPSKSLIRNMKKYDYTITVNRAFEQVIRSCSLPRSYANETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  +F  GY +++E W+++ LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIEGYCGMFDAGYGYSVEVWQEEQLVGGLYGVTIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++  +Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQEYLKSLQDVIIHPSINW 222


>gi|197264238|ref|ZP_03164312.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197242493|gb|EDY25113.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
          Length = 234

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + ++++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMRRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQP 218


>gi|300722515|ref|YP_003711805.1| leucyl, phenylalanyl-tRNA -protein transferase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629022|emb|CBJ89607.1| leucyl, phenylalanyl-tRNA-protein transferase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 235

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 84/156 (53%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++     H  + L+++IR+  Y I +N AF+ VI +CAQ+ +    TWI   
Sbjct: 57  WWSPDPRAVLIPGELHIGRTLRRFIRKHTYQITVNYAFDRVIYSCAQRQEG---TWIGSE 113

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +Q  Y  L   G AH+IE W +  LVGGLYGV +GA+F GESMFS MENASK        
Sbjct: 114 VQSGYQTLHQEGLAHSIEVWHEHQLVGGLYGVCIGALFCGESMFSKMENASKCAFIAFYH 173

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GA  I   ++ + L
Sbjct: 174 HFLRHGGQLFDCQVLNHHTESLGAKNIQREEFLQHL 209


>gi|237809060|ref|YP_002893500.1| leucyl/phenylalanyl-tRNA--protein transferase [Tolumonas auensis
           DSM 9187]
 gi|259494911|sp|C4L944|LFTR_TOLAT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|237501321|gb|ACQ93914.1| leucyl/phenylalanyl-tRNA/protein transferase [Tolumonas auensis DSM
           9187]
          Length = 234

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 86/160 (53%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q I W  P  RG++P+   H  + L+K + +      +N AF  V++ACA   +    TW
Sbjct: 55  QPILWWSPDPRGVLPVAQLHISRSLRKTLNKTSLRFTVNHAFMDVVTACAAPRRYSEDTW 114

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I     ++Y  L  MG AH++E W  D LVGGLYG+S+G +F GESMF    +ASK+ L 
Sbjct: 115 ITSEFMQSYAVLHEMGQAHSVEVWDNDQLVGGLYGLSVGKLFCGESMFHRQTDASKLALV 174

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L +HL +    L+D Q   ++L   G  E    ++ + L
Sbjct: 175 ALCRHLSRYDAPLIDCQMQNSYLETMGVQEWPRAEFLRQL 214


>gi|300113232|ref|YP_003759807.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitrosococcus
           watsonii C-113]
 gi|299539169|gb|ADJ27486.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitrosococcus
           watsonii C-113]
          Length = 240

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 95/171 (55%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             Q I W  P  R ++  +  H  + L+K +RRE Y + ++  F  VI ACA   Q    
Sbjct: 55  QGQPILWWSPDPRLVLFPQQLHISRSLRKRLRRETYQVTLDLDFPGVIEACASPRQDEGG 114

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   ++ AY  L  MG AH++E W+   L+GGLYGVS+G +FFGESMFS   +ASKI 
Sbjct: 115 TWITPEMKSAYNRLHKMGIAHSVETWEGKALIGGLYGVSIGRIFFGESMFSKRPDASKIA 174

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +L + L++  F L+D Q  + HL++ GA  +   ++   L+     P +
Sbjct: 175 FVYLCRQLQRWGFPLIDCQIQSEHLQRLGAQTLPRSKFLHWLQELSHSPSL 225


>gi|54294655|ref|YP_127070.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           pneumophila str. Lens]
 gi|61213289|sp|Q5WVS9|LFTR_LEGPL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|53754487|emb|CAH15971.1| hypothetical protein lpl1732 [Legionella pneumophila str. Lens]
          Length = 222

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 1/164 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R I+    F   + LKK +++  + + ++TAF+ VIS CA  + +   TWI   
Sbjct: 52  WWSPNPRLILIPNEFKISRSLKKTLKKP-FKLTVDTAFQRVISYCATCSDRANKTWITSE 110

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           + + Y  L  MGYAH+ E W    LVGGLYG+SLG  FFGESMF  + +ASK+ L  L  
Sbjct: 111 MIETYTQLHEMGYAHSFEIWDGSELVGGLYGISLGHAFFGESMFHTITDASKVALHFLCS 170

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
            ++   F  +D Q  T HL + GA  I+  ++  +L+  LK+P+
Sbjct: 171 IMQSWNFDFIDCQLPTLHLMRLGAKIISRKEFLHMLQETLKYPD 214


>gi|156934620|ref|YP_001438536.1| hypothetical protein ESA_02454 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532874|gb|ABU77700.1| hypothetical protein ESA_02454 [Cronobacter sakazakii ATCC BAA-894]
          Length = 196

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +I  E  H  + +K++ RR  Y + +N AF +VI  CA  + +   TWI 
Sbjct: 18  ILWWSPDPRAVIWPERLHISRSMKRFHRRSPYRVTLNHAFNAVIQGCA--SDRDDGTWIT 75

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  A+  L  +G+AH++E W+ D LVGG+YGV+ GA+F GESMFS  ENASK  L   
Sbjct: 76  NDVVIAWQRLHELGHAHSVEVWQDDTLVGGMYGVAQGALFCGESMFSRRENASKTALVVF 135

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             +   +   L+D Q +  H    GA+EI    Y + L
Sbjct: 136 CDYFVAQGGRLIDCQVLNPHTASLGAVEIPRRDYLQHL 173


>gi|260061574|ref|YP_003194654.1| leucyl/phenylalanyl-tRNA--protein transferase [Robiginitalea
           biformata HTCC2501]
 gi|88785706|gb|EAR16875.1| leucyl/phenylalanyl-tRNA--protein transferase [Robiginitalea
           biformata HTCC2501]
          Length = 243

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R ++  +     + +++ I ++ + I  N  F  VISACA+ ++K +  TWI
Sbjct: 75  ILWWSPDPRMVLFPDELRITRSMRRIIGKKTFRITKNQCFAEVISACAETSRKGQDGTWI 134

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              ++ AYI L   G A + EAW+   LVGGLYGV LG VF GESMF+ + NASK    H
Sbjct: 135 TPGMEAAYIRLHEAGNAVSYEAWQGSELVGGLYGVDLGEVFCGESMFTRVSNASKAAFIH 194

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           +V+ L+++ + L+D Q  T HL   GA  ++  Q+  LL+ 
Sbjct: 195 MVRELEEKNYRLIDCQVHTPHLESLGARLVSRAQFLNLLKG 235


>gi|167562877|ref|ZP_02355793.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           oklahomensis EO147]
 gi|167570063|ref|ZP_02362937.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           oklahomensis C6786]
          Length = 253

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 98/181 (54%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGII-PLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQ 58
           ++ Q + W  P  R I+ P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ
Sbjct: 52  SDGQPVLWWSPDPRMILAPTEFKISATFR--KTLKRVLREPRWEIRVDCDFAGVMRACAQ 109

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++ 
Sbjct: 110 APRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAD 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           + +ASKI    LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I 
Sbjct: 170 VSDASKIAFAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVGEPAIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|325919557|ref|ZP_08181571.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas gardneri
           ATCC 19865]
 gi|325549966|gb|EGD20806.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas gardneri
           ATCC 19865]
          Length = 249

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 95/173 (54%), Gaps = 1/173 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           ++ Q I W  P  R +   +  H   R ++ +R   + +R +TAF  VI ACA   +  +
Sbjct: 55  SDDQPILWWSPDPRTVFRTDAVHLSSRFRRELRSSTWTVRADTAFAQVIDACASLPRAGQ 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q+AYI+L  +G+AH++E +    LVGG+YGV++G +FFGESMFS     SK
Sbjct: 115 HGTWITTPMQQAYIELHRLGHAHSLEVFDGARLVGGIYGVAIGQMFFGESMFSAESGGSK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           + L  L ++L    + L+D Q    HL + GA  +   Q+ + +   +  P +
Sbjct: 175 VALAALAEYLHGCGWPLIDAQVENPHLMRLGAQRLPRAQFLQQVRRQVTQPSL 227


>gi|161614815|ref|YP_001588780.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|168263559|ref|ZP_02685532.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|194443321|ref|YP_002040153.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|200389918|ref|ZP_03216529.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|205352163|ref|YP_002225964.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856347|ref|YP_002242998.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|189046559|sp|A9N7Y5|LFTR_SALPB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737717|sp|B5QYN6|LFTR_SALEP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737718|sp|B5R8H3|LFTR_SALG2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737720|sp|B4T119|LFTR_SALNS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|161364179|gb|ABX67947.1| hypothetical protein SPAB_02567 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401984|gb|ACF62206.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|199602363|gb|EDZ00909.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|205271944|emb|CAR36788.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205347788|gb|EDZ34419.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206708150|emb|CAR32443.1| leucyl/phenylalanyl-tRNA-protein transferase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|326627207|gb|EGE33550.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 234

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                +    L+D Q + +H    GAIEI    Y   L    + P
Sbjct: 174 CAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQP 218


>gi|260555764|ref|ZP_05827984.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter
           baumannii ATCC 19606]
 gi|260410675|gb|EEX03973.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter
           baumannii ATCC 19606]
          Length = 243

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 96/171 (56%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R +I  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCVIYPQNYKPSKSLIRNMKKYDYTITVNRAFEQVIRSCSLPRSYANETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  +F  GY +++E W+++ LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIEGYCGMFDAGYGYSVEVWQEEQLVGGLYGVTIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++  +Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQEYLKSLQDVIIHPSINW 222


>gi|157737341|ref|YP_001490024.1| leucyl/phenylalanyl-tRNA--protein transferase [Arcobacter butzleri
           RM4018]
 gi|157699195|gb|ABV67355.1| leucyl/phenylalanyl-tRNA--protein transferase [Arcobacter butzleri
           RM4018]
          Length = 222

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 93/162 (57%), Gaps = 1/162 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P +R ++  E F   K L+K I  + + ++ N  FE VI +CA+ K +    TWI
Sbjct: 61  IHWFSPQKRMVLYPENFKVSKSLRKSITNKGFVVKSNENFEEVIRSCAKIKRKHEDGTWI 120

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +    KAY +L  +  A +IE + KD LVGGLYGV +G +F GESMFS + + SK+   H
Sbjct: 121 SEEFIKAYTNLHELDIAFSIECYLKDELVGGLYGVLIGDIFCGESMFSLVPDTSKVAFYH 180

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           L +  K+    ++D Q   +HL   GA EIT  +Y  LL+++
Sbjct: 181 LCQQAKQNGIKIIDCQVYNDHLASLGAFEITRNEYFNLLKDS 222


>gi|262369134|ref|ZP_06062463.1| leucyl phenylalanyl-tRNA-protein transferase [Acinetobacter
           johnsonii SH046]
 gi|262316812|gb|EEY97850.1| leucyl phenylalanyl-tRNA-protein transferase [Acinetobacter
           johnsonii SH046]
          Length = 243

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 92/174 (52%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R II  + +   K L + ++++ Y I IN AFE VI AC+       
Sbjct: 49  STGEPICWWCPEPRCIIRPQDYQPSKTLLRSMKKQDYRITINQAFERVIRACSLPRSYAD 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  I   Y  +F  GY +++E W +  LVGGLYGVS+G   FGESMFS   + SK+
Sbjct: 109 DTWISEDIIDGYCAMFDAGYGYSVEVWDQTRLVGGLYGVSIGHGCFGESMFSTETDVSKM 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
               L+   ++ +   +D Q + NHL   GA  ++   Y K L++ +  P I +
Sbjct: 169 AFYTLMLIGRENKLPWIDCQLVNNHLLSLGACTLSRQTYLKSLQDVVNQPAIDW 222


>gi|127512498|ref|YP_001093695.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella loihica
           PV-4]
 gi|158513471|sp|A3QD88|LFTR_SHELP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|126637793|gb|ABO23436.1| Leucyltransferase [Shewanella loihica PV-4]
          Length = 236

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 87/164 (53%), Gaps = 1/164 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N  D I W  P  R +    +    + LK+ I+R  +   +N AF SVI  CA   Q + 
Sbjct: 52  NENDPILWWSPDPRAVFVPGSLKVSRSLKRDIKRRQWRFSVNRAFNSVIEHCALTRQGKE 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI + IQ+AY  L     AH+IE W  D L+GGLYGV++G VF GESMF    NASK 
Sbjct: 112 GTWITLEIQQAYKALHKYNKAHSIEVWDGDKLIGGLYGVAIGQVFCGESMFHLQSNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +  L +HL   ++ L+D Q +  HL   GA  +    +  LL+
Sbjct: 172 AMAMLHQHLLSHRYRLIDAQVMNPHLASLGAKALKRADFINLLK 215


>gi|74311443|ref|YP_309862.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella sonnei
           Ss046]
 gi|119367727|sp|Q3Z3N5|LFTR_SHISS RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|73854920|gb|AAZ87627.1| leucyl, phenylalanyl-tRNA-protein transferase [Shigella sonnei
           Ss046]
 gi|323165821|gb|EFZ51607.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella sonnei 53G]
          Length = 234

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W +D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWHEDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + +H    GA EI    Y   L
Sbjct: 174 CEEFISHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|260552500|ref|ZP_05825876.1| leucyl phenylalanyl-tRNA-protein transferase [Acinetobacter sp.
           RUH2624]
 gi|260405307|gb|EEW98803.1| leucyl phenylalanyl-tRNA-protein transferase [Acinetobacter sp.
           RUH2624]
          Length = 243

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 94/171 (54%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R +I  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCVIYPQNYKPSKSLIRNMKKHDYTITVNRAFEQVIRSCSLPRSYANETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  LF  GY ++IE W+   LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIQGYCALFNSGYGYSIEVWQDKQLVGGLYGVTIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++  +Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQEYLKSLQDVIIHPSINW 222


>gi|121599188|ref|YP_993056.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           SAVP1]
 gi|126450066|ref|YP_001080336.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           NCTC 10247]
 gi|254178738|ref|ZP_04885393.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           ATCC 10399]
 gi|254199864|ref|ZP_04906230.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           FMH]
 gi|254206192|ref|ZP_04912544.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           JHU]
 gi|254358590|ref|ZP_04974863.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           2002721280]
 gi|121227998|gb|ABM50516.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           SAVP1]
 gi|126242936|gb|ABO06029.1| leucyltransferase [Burkholderia mallei NCTC 10247]
 gi|147749460|gb|EDK56534.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           FMH]
 gi|147753635|gb|EDK60700.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           JHU]
 gi|148027717|gb|EDK85738.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           2002721280]
 gi|160699777|gb|EDP89747.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia mallei
           ATCC 10399]
          Length = 199

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 95/174 (54%), Gaps = 9/174 (5%)

Query: 12  WIKPLRRGI-IPLE-----TFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RP 64
           W  P  R I +P E     TF   K LK+ +R   ++IR++  F  V+ ACAQ  ++ + 
Sbjct: 3   WWSPDPRMILVPAEFRISATFR--KTLKRVLREPRWEIRVDYDFAGVMRACAQAPRRGQR 60

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   I  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++H  +ASKI
Sbjct: 61  GTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAHASDASKI 120

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L  LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+  P I +
Sbjct: 121 ALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIPW 174


>gi|220909258|ref|YP_002484569.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp. PCC
           7425]
 gi|219865869|gb|ACL46208.1| leucyl/phenylalanyl-tRNA/protein transferase [Cyanothece sp. PCC
           7425]
          Length = 202

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 104/174 (59%), Gaps = 6/174 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MA+S  S ++ W     R +IPL E F  P+ L++ + +  + + IN  F  V++ CA  
Sbjct: 20  MAESDGS-NLGWYASRERTLIPLDERFRYPRSLRRVLNQNRFRVAINQDFAGVVAGCAD- 77

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R +TWI+  +++ Y  L+  G+A++ E W+ D L GG+ G+ +G  F GESMF  + 
Sbjct: 78  ---RESTWISAELKQIYYALYENGWAYSFETWQGDELAGGILGIVIGGAFIGESMFYRIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             SK+ +  LV+HL+ RQF+L D Q +  HL +FGA +I+  +Y KLL+ A++ 
Sbjct: 135 EGSKVAMVKLVEHLRSRQFVLFDAQMMNPHLERFGACKISDREYDKLLKKAIRR 188


>gi|312796577|ref|YP_004029499.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           rhizoxinica HKI 454]
 gi|312168352|emb|CBW75355.1| Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)
           [Burkholderia rhizoxinica HKI 454]
          Length = 246

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTP----KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           +  Q + W  P  R I+    F       K LKK +R   ++IR++  F  V+ ACA   
Sbjct: 52  SKGQPVLWWSPDPRMILVPSEFKVSISLRKSLKKVLREPSWEIRVDAGFADVMHACANAN 111

Query: 61  Q-KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI   +  AY  L   G AH++E W +   VGGLYGVSLG +F+GESMF+H  
Sbjct: 112 RHGQHGTWITPEVIAAYEALHRAGLAHSVETWVEGQRVGGLYGVSLGRMFYGESMFAHRT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASK+ L  L+ HL++ +  ++D Q  T HL   GA E++   +   +  A++H  I +
Sbjct: 172 DASKVALAALIAHLREHRVDMVDCQQNTAHLASLGAREVSRRTFIAHMRAAIRHSPIPW 230


>gi|134295627|ref|YP_001119362.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           vietnamiensis G4]
 gi|166224660|sp|A4JE24|LFTR_BURVG RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|134138784|gb|ABO54527.1| Leucyltransferase [Burkholderia vietnamiensis G4]
          Length = 254

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 96/179 (53%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGII-PLETFHTP---KRLKKYIRRELYDIRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+ P E   +P   K LK+ +R   +++R++  F  V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLKRVLRDAAWEVRVDHDFAGVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L   G AH+IE W     VGGLYGV+ G +FFGESM++   
Sbjct: 112 RRGQRGTWITAEIIDAYTSLHRSGNAHSIETWHDGRRVGGLYGVAFGRMFFGESMYADAT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV HL+ +   ++D Q  T+HL   G  EI    +   +  A   P I +
Sbjct: 172 DASKIALATLVAHLRDQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAAAEPPIPW 230


>gi|163802081|ref|ZP_02195977.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio sp. AND4]
 gi|159174222|gb|EDP59030.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio sp. AND4]
          Length = 236

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 89/161 (55%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +     F   K LKK+ R++ Y + +N A E VI  C+  T+    T
Sbjct: 54  GEPILWWSPSPRAVFDPLLFKPSKSLKKFQRKQQYKVTLNNATERVIQLCS-CTRPAEET 112

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q +Y  L   G+ H++E W  + L+GGLYG+S+G +F GESMFS  +NASKI L
Sbjct: 113 WLNEEMQASYTQLAKHGHCHSVEVWHDEQLIGGLYGISVGQLFCGESMFSLKDNASKIAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +L  HL      L+D Q +  HL   GA+E+    + + L
Sbjct: 173 WYLCDHLATNLGQLIDCQVMNPHLASLGALELDRDDFIQKL 213


>gi|237711934|ref|ZP_04542415.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp.
           9_1_42FAA]
 gi|237725807|ref|ZP_04556288.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp. D4]
 gi|229435615|gb|EEO45692.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides dorei
           5_1_36/D4]
 gi|229454629|gb|EEO60350.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp.
           9_1_42FAA]
          Length = 217

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 88/165 (53%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  PL+R +I     H    ++  + +  Y +  N AF  VI  C     +    W
Sbjct: 51  KQIQWWCPLKRFVIFPNEIHISHSMRTLMNKGRYGVSFNQAFHEVIQTCGNLRMEEAGAW 110

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           +   I KAY  L   G+A ++E W++  LVGGLYGV+LG  FFGESMFS + NASK+ L 
Sbjct: 111 LGEDIMKAYTRLHEQGFAASVEVWEESCLVGGLYGVTLGKCFFGESMFSLVPNASKLALI 170

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +L +  ++    L+D QF T HL+  G   I + +Y + ++   +
Sbjct: 171 YLAQTFQELGGTLIDCQFETPHLKSMGGRYIDYEEYMRYVQEPFE 215


>gi|83645156|ref|YP_433591.1| leucyl/phenylalanyl-tRNA--protein transferase [Hahella chejuensis
           KCTC 2396]
 gi|119367697|sp|Q2SJK8|LFTR_HAHCH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|83633199|gb|ABC29166.1| leucyl/phenylalanyl-tRNA--protein transferase [Hahella chejuensis
           KCTC 2396]
          Length = 234

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 87/164 (53%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R II  E  H  + +++++R        +  F  V+ ACA       
Sbjct: 51  SEDQPILWWSPDPRCIIRHEDLHISRSMRRFLRNSGLTYSFDQHFTLVVQACAAPRSYSN 110

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY DL  +G AH+IE W++  LVGGLYG+++G  FFGESMFS   NASK 
Sbjct: 111 ETWITRDMLQAYSDLHQIGVAHSIEVWRESELVGGLYGLAIGRCFFGESMFSKETNASKA 170

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
               LV+ L    + L+D Q    HL   GA +I+  ++  +LE
Sbjct: 171 AFITLVRQLHAWGYRLIDCQVPNPHLLSLGACQISRKEFLSILE 214


>gi|323969616|gb|EGB64903.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           TA007]
          Length = 234

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MEN SK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENTSKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|212691638|ref|ZP_03299766.1| hypothetical protein BACDOR_01133 [Bacteroides dorei DSM 17855]
 gi|265753169|ref|ZP_06088738.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp.
           3_1_33FAA]
 gi|212665827|gb|EEB26399.1| hypothetical protein BACDOR_01133 [Bacteroides dorei DSM 17855]
 gi|263236355|gb|EEZ21850.1| leucyl/phenylalanyl-tRNA-protein transferase [Bacteroides sp.
           3_1_33FAA]
          Length = 217

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 88/165 (53%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  PL+R +I     H    ++  + +  Y +  N AF  VI  C     +    W
Sbjct: 51  KQIQWWCPLKRFVIFPNEIHISHSMRTLMNKGRYGVSFNQAFHEVIQTCGNLRMEEAGAW 110

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           +   I KAY  L   G+A ++E W++  LVGGLYGV+LG  FFGESMFS + NASK+ L 
Sbjct: 111 LGEDIMKAYTRLHEQGFAASVEVWEESCLVGGLYGVTLGKCFFGESMFSLVPNASKLALI 170

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           +L +  ++    L+D QF T HL+  G   I + +Y + ++   +
Sbjct: 171 YLAQTFQELGGTLIDCQFETPHLKSMGGRYIDYEEYMRYVQEPFE 215


>gi|26246911|ref|NP_752951.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           CFT073]
 gi|218700599|ref|YP_002408228.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           IAI39]
 gi|227884148|ref|ZP_04001953.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           83972]
 gi|300937622|ref|ZP_07152431.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           21-1]
 gi|300978551|ref|ZP_07174304.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           45-1]
 gi|301047857|ref|ZP_07194907.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           185-1]
 gi|33301298|sp|Q8FJD1|LFTR_ECOL6 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226736774|sp|B7NM92|LFTR_ECO7I RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|26107311|gb|AAN79494.1|AE016758_98 Leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           CFT073]
 gi|218370585|emb|CAR18392.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           IAI39]
 gi|227838900|gb|EEJ49366.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           83972]
 gi|300300285|gb|EFJ56670.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           185-1]
 gi|300409630|gb|EFJ93168.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           45-1]
 gi|300457352|gb|EFK20845.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           21-1]
 gi|307552727|gb|ADN45502.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli ABU
           83972]
 gi|315291244|gb|EFU50604.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli MS
           153-1]
          Length = 234

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W +D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWCEDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +        L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|149924040|ref|ZP_01912422.1| leucyl/phenylalanyl-tRNA--protein transferase [Plesiocystis
           pacifica SIR-1]
 gi|149815072|gb|EDM74626.1| leucyl/phenylalanyl-tRNA--protein transferase [Plesiocystis
           pacifica SIR-1]
          Length = 239

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 99/175 (56%), Gaps = 6/175 (3%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           + W  P  R ++        + L+K +RR  Y +  + AF  VI  CA+  +  +  TWI
Sbjct: 53  VLWHSPDPRFVLEPRELRVNRSLRKALRRRPYRVTFDQAFTEVIRRCAEVPRPGQDGTWI 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AY  L  +GYAH++EAW+ + LVGG+YGVS+GA+F GESMFS   +ASK+   H
Sbjct: 113 TDDMIAAYESLARLGYAHSVEAWRDEELVGGIYGVSVGALFCGESMFSLAPDASKVAFVH 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY----AKLLENALKH-PEISF 178
           LV+ L+     L+D Q  T+HL +FG       ++    A+L E  L+  PE+++
Sbjct: 173 LVRQLETWGCGLIDCQVHTHHLERFGGCHWPRERFLGAVAELRERPLEQGPELAW 227


>gi|260768163|ref|ZP_05877097.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio furnissii CIP
           102972]
 gi|260616193|gb|EEX41378.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio furnissii CIP
           102972]
          Length = 242

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 87/161 (54%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K +KK+ R+  Y + IN A   VI  CA   +    T
Sbjct: 55  GEPILWWSPSPRAVFDPKTFIPAKSVKKFQRKHQYTVSINHATTDVIEMCA-AVRSPQET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +++AY  L   G  H++E W+ D LVGGLYG+ +G +F GESMFS   NASKI L
Sbjct: 114 WLNEPMRQAYGQLAREGKCHSVEVWQHDTLVGGLYGIEVGQLFCGESMFSTATNASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +   H    Q  L+D Q +  HL+  GA E++   + + L
Sbjct: 174 WYFCHHFSTHQGKLIDCQVMNPHLKSLGAKELSRDNFMQSL 214


>gi|169796945|ref|YP_001714738.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AYE]
 gi|213156651|ref|YP_002318312.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB0057]
 gi|215484407|ref|YP_002326638.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB307-0294]
 gi|294839629|ref|ZP_06784312.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter sp.
           6013113]
 gi|294859825|ref|ZP_06797594.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter sp.
           6013150]
 gi|301346622|ref|ZP_07227363.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB056]
 gi|301510649|ref|ZP_07235886.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB058]
 gi|301595270|ref|ZP_07240278.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB059]
 gi|169149872|emb|CAM87763.1| leucyl, phenylalanyl-tRNA-protein transferase [Acinetobacter
           baumannii AYE]
 gi|213055811|gb|ACJ40713.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB0057]
 gi|213987202|gb|ACJ57501.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii AB307-0294]
          Length = 243

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 95/171 (55%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R II  + +   K L + +++  Y I +N AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCIIYPQNYKPSKSLIRNMKKYDYTITVNRAFEQVIRSCSLPRSYANETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  +F  GY +++E W+++ LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIEGYCGMFDAGYGYSVEVWQEEQLVGGLYGVTIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++   Y K L++ + HP I++
Sbjct: 172 TLMLIGQENQLPWVDCQLVNSHLISLGACTLSRQGYLKSLQDVIIHPSINW 222


>gi|296103109|ref|YP_003613255.1| leucyl/phenylalanyl-tRNA--protein transferase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295057568|gb|ADF62306.1| leucyl/phenylalanyl-tRNA--protein transferase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 234

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 86/161 (53%), Gaps = 2/161 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++    FH  + +K++  +  Y + +N AF  VI  CA+   +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPTQFHLSRSMKRFHAKSPYRVTLNHAFGQVIEGCAEDRHE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I  AY  L  +GYAH+IE W+   LVGG+YGV+ G +F GESMFS   NASK  L   
Sbjct: 114 RDIITAYHQLHELGYAHSIEVWEGGELVGGMYGVAQGTLFCGESMFSRAVNASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
            +   +R   LLD Q +  H    GA+EI+   Y + L+N 
Sbjct: 174 CQEFAQRGGQLLDCQVLNEHTASLGAVEISRRHYIEHLDNC 214


>gi|170769158|ref|ZP_02903611.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia albertii
           TW07627]
 gi|170121810|gb|EDS90741.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia albertii
           TW07627]
          Length = 234

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 87/161 (54%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
              I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   T
Sbjct: 53  GDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTLNYAFGKVIEGCASNREE--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI  ++ +AY  L  +G+AH+IE W+++ LVGG+YGV+ G +F GESMFS MENASK  L
Sbjct: 111 WITRSVIEAYHRLHELGHAHSIEVWRENELVGGMYGVAQGTLFCGESMFSRMENASKTAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +        L+D Q +  H    GA EI    Y   L
Sbjct: 171 LVFCEEFIHHGGKLIDCQVLNEHTASLGACEIPRRDYLSYL 211


>gi|254496572|ref|ZP_05109440.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           drancourtii LLAP12]
 gi|254354196|gb|EET12863.1| leucyl/phenylalanyl-tRNA--protein transferase [Legionella
           drancourtii LLAP12]
          Length = 226

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 96/171 (56%), Gaps = 2/171 (1%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           S  S  + W    R  +IP E F     L+K +++  +    +TAF  V+ ACA  + + 
Sbjct: 47  SPGSPVLWWSPNPRLILIPTE-FKVSHSLQKALKKP-FRFTTDTAFRQVMIACATCSDRL 104

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   + + Y  L  MGYAH+ E W+ + LVGGLYGVSLG VFFGESMF  +++ SK
Sbjct: 105 DNTWITNEMIETYTQLHTMGYAHSFEIWQDEELVGGLYGVSLGRVFFGESMFHTVKDTSK 164

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           I   HL + +    F  +D Q  T HL+  GA  +   ++ +LL ++L++P
Sbjct: 165 IAFYHLCQVMADWNFNFIDCQLPTPHLQSLGAKIVARNEFLRLLAHSLEYP 215


>gi|119470163|ref|ZP_01612929.1| leucyl, phenylalanyl-tRNA-protein transferase [Alteromonadales
           bacterium TW-7]
 gi|119446584|gb|EAW27858.1| leucyl, phenylalanyl-tRNA-protein transferase [Alteromonadales
           bacterium TW-7]
          Length = 238

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 86/169 (50%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++++ I W  P  RGI+ L  FH  K L+K++++    + +N AF  VI AC  +     
Sbjct: 53  SDNEPIMWWSPSERGIVELNEFHVSKSLRKHLKKYPVTVTVNNAFVEVIEACRDQRIDTD 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AYI+  + G AH++E W+   L GGLYG+    VF GESMF H  N SK+
Sbjct: 113 GTWITNDMLSAYINAHHAGIAHSLEVWRNGELAGGLYGIMQNGVFCGESMFHHQTNCSKL 172

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
            +  LV  LK      +D Q    +L   GA  I    +   L  AL +
Sbjct: 173 AMWALVNWLKNHDAHFIDCQLENPYLMSLGAKVIPRTDFLAKLSTALTY 221


>gi|167003924|ref|ZP_02269703.1| leucyltransferase [Burkholderia mallei PRL-20]
 gi|238563296|ref|ZP_00439081.2| leucyltransferase [Burkholderia mallei GB8 horse 4]
 gi|238520960|gb|EEP84415.1| leucyltransferase [Burkholderia mallei GB8 horse 4]
 gi|243060616|gb|EES42802.1| leucyltransferase [Burkholderia mallei PRL-20]
          Length = 190

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 86/150 (57%), Gaps = 1/150 (0%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTI 88
           K LK+ +R   ++IR++  F  V+ ACAQ  ++ +  TWI   I  AY  L   G AH+I
Sbjct: 16  KTLKRVLREPRWEIRVDYDFAGVMRACAQAPRRGQRGTWITAEIIDAYSSLHRAGDAHSI 75

Query: 89  EAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITN 148
           E W     VGGLYGVS G +FFGESM++H  +ASKI L  LV HL++ +  ++D Q  T+
Sbjct: 76  ETWLDGRRVGGLYGVSFGRMFFGESMYAHASDASKIALAALVAHLREHRVEMIDCQQNTS 135

Query: 149 HLRQFGAIEITHVQYAKLLENALKHPEISF 178
           HL   G  EI    +   +  A+  P I +
Sbjct: 136 HLASLGGREIARKTFVAHVRRAVAEPPIPW 165


>gi|77360661|ref|YP_340236.1| leucyl/phenylalanyl-tRNA--protein transferase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|119367709|sp|Q3IH36|LFTR_PSEHT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|76875572|emb|CAI86793.1| leucyl, phenylalanyl-tRNA-protein transferase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 238

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 86/163 (52%), Gaps = 1/163 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  RGI+ L+ FH  K L+K++++    + IN AF  VI AC ++     
Sbjct: 53  SEDEPIMWWSPSERGIVELDNFHISKSLRKHLKKHPVTVTINNAFIEVIEACCEQRIDTD 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AYI+    G AH++E W++  L GGLYG+    VF GESMF H  N SK+
Sbjct: 113 GTWITSDMLTAYINAHNAGIAHSVEVWREGELAGGLYGIMQNGVFCGESMFHHQTNCSKL 172

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY-AKL 166
            +  LV  LK+     +D Q    +L   GA  I    + AKL
Sbjct: 173 AMWALVNWLKRHNAHFIDCQLENPYLMSLGATVIPRPAFLAKL 215


>gi|292487811|ref|YP_003530686.1| leucyl, phenylalanyl-tRNA-protein transferase [Erwinia amylovora
           CFBP1430]
 gi|292899041|ref|YP_003538410.1| leucyl/phenylalanyl-tRNA-protein transferase [Erwinia amylovora
           ATCC 49946]
 gi|291198889|emb|CBJ45999.1| leucyl/phenylalanyl-tRNA-protein transferase [Erwinia amylovora
           ATCC 49946]
 gi|291553233|emb|CBA20278.1| leucyl, phenylalanyl-tRNA-protein transferase [Erwinia amylovora
           CFBP1430]
 gi|312171929|emb|CBX80186.1| leucyl, phenylalanyl-tRNA-protein transferase [Erwinia amylovora
           ATCC BAA-2158]
          Length = 230

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (55%), Gaps = 2/154 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  + FH  + +K++ +R  Y + +N  F  VI  CA   Q+   TWI 
Sbjct: 56  ILWWSPDPRAVLLPQHFHLSRSMKRFHQRSSYRVTLNHCFHDVIEGCACDRQE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ A+  L  +G+AH+IE W  D LVGG+YG++LG +F GESMFS  ENASK  L   
Sbjct: 114 HEVKHAWQRLHALGHAHSIEVWHGDELVGGMYGLALGRIFCGESMFSRRENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
             +  ++   L+D Q +  H R  GA EI+   Y
Sbjct: 174 CHYFLQQGGRLIDCQVLNPHTRSLGAQEISRASY 207


>gi|330829983|ref|YP_004392935.1| Leucyl/phenylalanyl-tRNA--protein transferase [Aeromonas veronii
           B565]
 gi|328805119|gb|AEB50318.1| Leucyl/phenylalanyl-tRNA--protein transferase [Aeromonas veronii
           B565]
          Length = 235

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 9/180 (5%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           Q   W  P  RG+I  +  H  + L+K IRR  +DI +N AF  VI+ACA   +    TW
Sbjct: 56  QPTLWWSPDPRGVIRPDQLHVGRTLQKIIRRTPFDISVNRAFNEVITACAAPRRTADGTW 115

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  + + Y  L  +G+AH+IE W++  L  GLYG+S+G +F GESMFS ++N +K+ + 
Sbjct: 116 ISQPMIETYQQLHRLGHAHSIEIWQEGELQAGLYGLSIGRLFCGESMFSRIDNGAKLAMV 175

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFG---------AIEITHVQYAKLLENALKHPEISF 178
            L +H  +    L+D Q     L   G           E+  + +  LL +  +  EIS 
Sbjct: 176 ALCRHFARHHGALIDCQMQNPFLATLGIEEWPRARFLAELARLGHQPLLASCWQEGEISL 235


>gi|284050648|ref|ZP_06380858.1| leucyl/phenylalanyl-tRNA--protein transferase [Arthrospira
           platensis str. Paraca]
 gi|291568707|dbj|BAI90979.1| leucyl/phenylalanyl-tRNA--protein transferase [Arthrospira
           platensis NIES-39]
          Length = 203

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 100/164 (60%), Gaps = 5/164 (3%)

Query: 10  ISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           + W    +R +IPL+  FH P+ L++++ +  + + IN  FE+VI  CA     R  TWI
Sbjct: 27  LGWYSSHQRALIPLDQRFHYPRSLQRFLNQNRFQVAINRDFEAVIQGCA----DRENTWI 82

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +  +++ Y  L   G+A++ E W+ D L GG+ G+++G  F GESMF ++ N SK+ +  
Sbjct: 83  SGELKRIYRLLNSQGWAYSFETWEGDRLAGGILGIAIGGAFIGESMFFNIPNGSKVAMVK 142

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           LV+HL+KR F+L D Q    HL +FGA  I+  QY +LL  ALK
Sbjct: 143 LVEHLRKRDFVLFDAQMTNPHLERFGAFIISKNQYNQLLSKALK 186


>gi|323976729|gb|EGB71817.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           TW10509]
          Length = 234

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W +D LVGG+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWCEDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + +H    GA EI    Y   L
Sbjct: 174 CEEFIGHGGKLIDCQVLNDHTASLGACEILRRDYLNYL 211


>gi|119503239|ref|ZP_01625323.1| leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2080]
 gi|119460885|gb|EAW41976.1| leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2080]
          Length = 251

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 88/167 (52%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + I W  P  R I+    F   K   K +++  Y + +N  F SV+ ACA     + 
Sbjct: 44  SSDEPILWWAPDPRAILEPSEFIVSKSFGKSLKKRGYRLSLNKEFSSVVKACAAPRPSQE 103

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI  ++  AY  L  +GYAH+IE W +D L+GGLYGV +G  FFGESMFS   +ASK 
Sbjct: 104 GTWILPSMISAYSALHRLGYAHSIEVWCEDNLIGGLYGVCIGKAFFGESMFSVKTDASKT 163

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            L  L    +   F L+D Q  + HL   GA  +    +   LENA+
Sbjct: 164 ALASLAYIGQMGYFKLIDCQVESQHLTSMGARSLDRAVFEHKLENAI 210


>gi|110804886|ref|YP_688406.1| leucyl/phenylalanyl-tRNA--protein transferase [Shigella flexneri 5
           str. 8401]
 gi|123343207|sp|Q0T8P1|LFTR_SHIF8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|110614434|gb|ABF03101.1| leucyl, phenylalanyl-tRNA-protein transferase [Shigella flexneri 5
           str. 8401]
          Length = 234

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LV G+YGV+ G +F GESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVAGMYGVAQGTLFCGESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + +H    GA EI    Y   L
Sbjct: 174 CEEFIGHAGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|260597288|ref|YP_003209859.1| leucyl/phenylalanyl-tRNA--protein transferase [Cronobacter
           turicensis z3032]
 gi|260216465|emb|CBA29602.1| Leucyl/phenylalanyl-tRNA--protein transferase [Cronobacter
           turicensis z3032]
          Length = 244

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 89/165 (53%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  +  H  + +K++ RR  Y + +N AF +VI  CA  + +   TWI 
Sbjct: 66  ILWWSPDPRAVLWPDRLHVSRSMKRFHRRSPYRVTLNHAFSAVIQGCA--SDRDDGTWIT 123

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  A+  L  +G+AH+IE W+ D LVGG+YGV+ GA+F GESMFS  ENASK  L   
Sbjct: 124 NDVVIAWQRLHELGHAHSIEVWQDDELVGGMYGVAQGALFCGESMFSRRENASKTALVVF 183

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             +   +   L+D Q +  H    GA+EI    Y + L    + P
Sbjct: 184 CDYFLTQGGRLIDCQVLNPHTASLGAVEIPRRDYLQQLAELRQLP 228


>gi|114776569|ref|ZP_01451614.1| leucyl/phenylalanyl-tRNA--protein transferase [Mariprofundus
           ferrooxydans PV-1]
 gi|114553399|gb|EAU55797.1| leucyl/phenylalanyl-tRNA--protein transferase [Mariprofundus
           ferrooxydans PV-1]
          Length = 209

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 94/166 (56%), Gaps = 1/166 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           A  Q I W  P  R ++  + FH  +RL + +++  Y    N AF  VI+ CA   +K  
Sbjct: 40  AEGQPILWWSPDPRMVLFPDEFHCSRRLSRRLKQVRYRFSRNEAFADVINLCANIPRKGE 99

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +++AY+ L  +G+AH++E W+ + L+GG+YGV    VFF ESMFS   +ASK
Sbjct: 100 QGTWILPEMKEAYLRLHELGFAHSVEVWEGESLIGGVYGVLTERVFFAESMFSLKTDASK 159

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           + L HLV   K   + ++D QF T+HL   GA EI   ++  L+  
Sbjct: 160 MALAHLVALAKAENWKVIDSQFHTDHLASLGAREIPRQRFLDLING 205


>gi|193064635|ref|ZP_03045714.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E22]
 gi|260843135|ref|YP_003220913.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O103:H2 str. 12009]
 gi|192927692|gb|EDV82307.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           E22]
 gi|257758282|dbj|BAI29779.1| leucyl/phenylalanyl-tRNA-protein transferase [Escherichia coli
           O103:H2 str. 12009]
          Length = 234

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F  ESMFS MENASK  L   
Sbjct: 114 RGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCSESMFSRMENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + +H    GA EI    Y   L
Sbjct: 174 CEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|320155840|ref|YP_004188219.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio vulnificus
           MO6-24/O]
 gi|326423945|ref|YP_004300165.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio vulnificus
           CMCP6]
 gi|123482577|sp|Q1RS89|LFTR_VIBVU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91983534|gb|ABE68813.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio vulnificus
           CMCP6]
 gi|319931152|gb|ADV86016.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio vulnificus
           MO6-24/O]
          Length = 237

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 85/161 (52%), Gaps = 1/161 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +    TF   K LKK+ R+  Y + IN A   VI  C   T+    T
Sbjct: 55  GEPILWWSPSTRAVFDPNTFLPAKSLKKFQRKAQYQVSINHATPEVIKLCG-NTRPAEET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  +Q AYI L   G  H++E W+   L+GG YG+S+G +F GESMFS   NASKI L
Sbjct: 114 WLNEEMQAAYISLALQGVCHSVEVWQDQRLIGGFYGLSIGELFCGESMFSLETNASKIAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +  +H  +    L+D Q + +HL   GA  +   ++ + L
Sbjct: 174 WYFCRHFSEHGGKLIDCQVMNSHLHSLGAFTLPREEFLQRL 214


>gi|330446450|ref|ZP_08310102.1| leucyl/phenylalanyl-tRNA--protein transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490641|dbj|GAA04599.1| leucyl/phenylalanyl-tRNA--protein transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 237

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 78/144 (54%), Gaps = 1/144 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  RGI    TF   + L+K+ R+  Y I IN A   VI  CA   +    TWI   
Sbjct: 60  WWSPTPRGIFDPSTFRPSRSLRKFFRKSGYKITINEACHDVIRHCA-SCRAPEQTWITEE 118

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +  AY  L  +G+ H+IE W  D LVGG+YGV +G +F GESMFS  +NASKI L    +
Sbjct: 119 MIAAYQTLHDLGFCHSIEVWADDELVGGIYGVEVGTIFCGESMFSLADNASKIALWQFCR 178

Query: 132 HLKKRQFLLLDIQFITNHLRQFGA 155
           +  ++   LLD Q +  HL   GA
Sbjct: 179 YFTEQGGTLLDCQMMNPHLESLGA 202


>gi|300716065|ref|YP_003740868.1| Leucyl, phenylalanyl-tRNA-protein transferase [Erwinia billingiae
           Eb661]
 gi|299061901|emb|CAX59017.1| Leucyl, phenylalanyl-tRNA-protein transferase [Erwinia billingiae
           Eb661]
          Length = 230

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 93/165 (56%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+FH  + +K++ ++  Y + +N +F  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAVLYPESFHLSRSMKRFHQQSPYRVTLNQSFYDVIEGCASNREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +++A++ LF  G+A +IE W ++ LVGG+YG++LG +F GESMFS  ENASK  L   
Sbjct: 114 NEVRRAWLKLFEAGHAQSIEVWHENELVGGIYGLALGQIFCGESMFSRRENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            ++ +++   ++D Q +  H    GA EI    Y   + +    P
Sbjct: 174 SRYFQQQGGKVIDCQVLNPHTASLGAEEIGRADYLHQVNSLADQP 218


>gi|124005101|ref|ZP_01689943.1| leucyl/phenylalanyl-tRNA--protein transferase [Microscilla marina
           ATCC 23134]
 gi|123989353|gb|EAY28914.1| leucyl/phenylalanyl-tRNA--protein transferase [Microscilla marina
           ATCC 23134]
          Length = 251

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 92/172 (53%), Gaps = 1/172 (0%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQK 62
           S     I W  P  R ++        K +++ +R+ L+++  +  F+ V+ AC Q K   
Sbjct: 63  SEEDPTIMWWAPDPRFVLYPTQLRVSKSMRQVLRKGLFEVTFDQRFKEVMIACQQIKRTG 122

Query: 63  RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
           +  TWI   + + Y  L   G+AH++E W++  LVGGLYGVSLG  FFGESMFS   NAS
Sbjct: 123 QQGTWITEDMLEGYCQLHAQGFAHSVEVWQQGQLVGGLYGVSLGHCFFGESMFSKASNAS 182

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           K     +V+ L+     L+D Q  T HL   GA EI   +Y   L+  L++P
Sbjct: 183 KAGFITMVQKLQLLGIKLIDCQVYTQHLESLGAEEIPRDEYMAQLKQHLQNP 234


>gi|311742215|ref|ZP_07716025.1| leucyltransferase [Aeromicrobium marinum DSM 15272]
 gi|311314708|gb|EFQ84615.1| leucyltransferase [Aeromicrobium marinum DSM 15272]
          Length = 212

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 93/171 (54%), Gaps = 9/171 (5%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + +D+ W  P+RRGI+  +  H  +          +   ++TAF  VI ACA  +  RP 
Sbjct: 43  DGRDLLWWSPMRRGILRPDDVH--ESRSLRRSMRRFTTTVDTAFTEVIDACADPS--RPG 98

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKD--VLVGGLYGVSLGAVFFGESMFSHMENASK 123
            WI+  ++ AY+ L  +G+AH+IE    D   LVGGLYG+S+G +F GESMF    +ASK
Sbjct: 99  AWIDRRVRDAYVRLHSLGWAHSIEVRDADDGALVGGLYGLSVGRLFAGESMFHRRTDASK 158

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             + HL + +      L+D+Q+ T HL   G +EI    Y  LL + +  P
Sbjct: 159 AAMVHLAEVVGDG---LVDVQWSTPHLASMGVVEIGRADYLDLLPSLVDDP 206


>gi|298491538|ref|YP_003721715.1| leucyl/phenylalanyl-tRNA/protein transferase ['Nostoc azollae'
           0708]
 gi|298233456|gb|ADI64592.1| leucyl/phenylalanyl-tRNA/protein transferase ['Nostoc azollae'
           0708]
          Length = 192

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 105/175 (60%), Gaps = 7/175 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD   S  + W       +IPL+  F  PK L++ + +E + + IN  F  V++ CA  
Sbjct: 19  MADE--SARLGWYGSKEHTLIPLDDRFRYPKSLQRVLNQEKFTVAINRDFFGVVAGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  ++K Y  L+  GYA++ E W+ + L GG+ G+ +G  F GESMF ++ 
Sbjct: 75  --NRETTWISPELKKIYWLLYQTGYAYSFETWQGNKLAGGILGIVIGGAFIGESMFYNIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             SK+ +  LV+ L++++F+L D Q +  HL +FGA  +++ +Y KLL+ AL+HP
Sbjct: 133 EGSKVAMVKLVERLRQKKFILFDAQMMNPHLARFGAYPVSNQEYEKLLQQALQHP 187


>gi|121604630|ref|YP_981959.1| leucyl/phenylalanyl-tRNA--protein transferase [Polaromonas
           naphthalenivorans CJ2]
 gi|120593599|gb|ABM37038.1| Leucyltransferase [Polaromonas naphthalenivorans CJ2]
          Length = 260

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 92/162 (56%), Gaps = 5/162 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKTQK 62
            Q + W  P  R ++    F   + L+K I R + D    IR ++AF+ VISACA K + 
Sbjct: 65  GQPVLWWSPDPRMVLQTRDFKLHRSLRKGIVRFMNDAHCEIRFDSAFQRVISACASKPRA 124

Query: 63  -RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +  TWI   +++AY +L   G+AH++E W    L GGLY V+LG + FGESMF+H  +A
Sbjct: 125 GQAGTWIVSEMEQAYGELHRAGHAHSVETWVNGELAGGLYCVNLGRMVFGESMFAHQTDA 184

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           SKI L  LV   + +   ++D Q  T HL   GA EI+  ++
Sbjct: 185 SKIALAALVAFCRAKGIAMIDCQQNTGHLASLGACEISRAEF 226


>gi|313836479|gb|EFS74193.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL037PA2]
 gi|314928934|gb|EFS92765.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL044PA1]
 gi|314971075|gb|EFT15173.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL037PA3]
 gi|328906619|gb|EGG26394.1| leucyltransferase [Propionibacterium sp. P08]
          Length = 243

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 100/182 (54%), Gaps = 15/182 (8%)

Query: 1   MADSANSQDI----SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISAC 56
           +AD   SQ++    +W  P+RRGI+        + L+K  + +     ++ AF+ VI+ C
Sbjct: 43  IADEEVSQELQGAAAWWSPMRRGILLPGQLKVARSLRKTTKHQT--TTVDRAFDEVITRC 100

Query: 57  AQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMF 115
           A  T  RP  WI+  + +AY  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF
Sbjct: 101 ADPT--RPYAWIDDRVMEAYGYLHGRGWAHSVETWDAQGRLVGGLYGVSVGGFFSGESMF 158

Query: 116 SHME---NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
              E   +ASK  L  LV  L      LLD+Q+ T HL   G IE+   +Y  LL +AL+
Sbjct: 159 HDPEYGRDASKTALMRLVCELGPG---LLDVQWSTPHLASLGVIEVDRAEYLALLSDALE 215

Query: 173 HP 174
            P
Sbjct: 216 RP 217


>gi|323967320|gb|EGB62743.1| leucyl/phenylalanyl-tRNA protein transferase [Escherichia coli
           M863]
 gi|327253672|gb|EGE65301.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           STEC_7v]
          Length = 234

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +   Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKHSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W +D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWCEDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L    +   +    L+D Q + +H    GA EI    Y   L
Sbjct: 169 ALLVFCEEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 211


>gi|149371944|ref|ZP_01891263.1| Leucyltransferase [unidentified eubacterium SCB49]
 gi|149355084|gb|EDM43645.1| Leucyltransferase [unidentified eubacterium SCB49]
          Length = 213

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 91/166 (54%), Gaps = 3/166 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            + + W  P  R ++  + F   K LKK +R   + +  NTAFE VI+ C+  K + +  
Sbjct: 48  DEPVMWWSPDPRMVLFPDNFKVSKSLKKTVRTNKFKVTFNTAFERVITQCSTVKREGQDG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG--AVFFGESMFSHMENASK 123
           TWI   +  AY  L  +G+A ++E W ++ LVGGLYG+ L    +F GESMF+ M +ASK
Sbjct: 108 TWITTEMLSAYKKLHELGHAISVEVWFEEQLVGGLYGIDLKDKKIFCGESMFALMSDASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           +   HLV  LKK  + L+D Q  T HL   GA EI    +   LE 
Sbjct: 168 VGFYHLVTRLKKENYQLIDCQVYTAHLESLGAEEINRFTFLSYLEG 213


>gi|114563422|ref|YP_750935.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           frigidimarina NCIMB 400]
 gi|122299545|sp|Q081G8|LFTR_SHEFN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|114334715|gb|ABI72097.1| Leucyltransferase [Shewanella frigidimarina NCIMB 400]
          Length = 235

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 89/164 (54%), Gaps = 3/164 (1%)

Query: 6   NSQD-ISWIKPLRRGII-PLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           N+ D I W  P  R +  P   F + K L K++++  +   IN AF  V++ CA     +
Sbjct: 51  NANDPILWWSPDPRAVFTPSHPFGS-KSLIKFLKKSAWRFTINQAFLDVVAGCAGPRNTQ 109

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  IQ AY +L   G+AH+IE W  + LVGGLYG+ +G +F GESMF    NASK
Sbjct: 110 DGTWISAEIQMAYYELHLQGHAHSIEVWDGEQLVGGLYGIPVGGIFCGESMFHRQTNASK 169

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                L +HL K  F L+D Q +  HL   GA  +   ++  +L
Sbjct: 170 AAFAILNQHLVKHDFQLIDAQVMNPHLVSLGAKALPRSEFLTIL 213


>gi|255534043|ref|YP_003094415.1| leucyl/phenylalanyl-tRNA/protein transferase [Pedobacter heparinus
           DSM 2366]
 gi|255347027|gb|ACU06353.1| leucyl/phenylalanyl-tRNA/protein transferase [Pedobacter heparinus
           DSM 2366]
          Length = 211

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 91/160 (56%), Gaps = 4/160 (2%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R +I  E     K + +  + +L++I  + AF+ V+  CA   +K +  TWI
Sbjct: 53  ICWYAPAERCVIFPENVKVSKSMDRIFKLKLFEITYDQAFKEVVENCAIINRKEQDGTWI 112

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +Q AY+DL   G+AH++E W+  +LVGGLYGV +  VF GESMFS   NASK  L  
Sbjct: 113 TKEMQTAYLDLHQRGHAHSVEVWQDGLLVGGLYGVQINQVFCGESMFSKASNASKAALIW 172

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           L ++   + F ++D Q   NHL   GA  I++ +Y  LL+
Sbjct: 173 LCRY---KDFNVIDCQLPNNHLMSLGAEMISNGRYLNLLK 209


>gi|152967204|ref|YP_001362988.1| leucyl/phenylalanyl-tRNA--protein transferase [Kineococcus
           radiotolerans SRS30216]
 gi|151361721|gb|ABS04724.1| Leucyltransferase [Kineococcus radiotolerans SRS30216]
          Length = 221

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 90/166 (54%), Gaps = 8/166 (4%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  RG++  E  H  + L++ +RR  +++R++TAF+ V++ CA     RP  WI   
Sbjct: 35  WWSPDPRGVLVPEDVHVSRSLRRAVRR--FEVRVDTAFDEVVAGCADPA--RPGAWITAE 90

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK---ICLTH 128
           + +AY  L  +G+AH++E W    L GGLYG+S+G +F  ES F  +  ASK   + L  
Sbjct: 91  VARAYARLHRLGWAHSVEVWCGGELAGGLYGLSIGGLFAAESKFHRVTGASKAAVVALAQ 150

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           LV     R   L+D+Q+ T HL   G  E+    Y + L  AL  P
Sbjct: 151 LVTADGVRG-RLVDVQWRTEHLATLGVREVPRAAYLRSLRAALALP 195


>gi|312885226|ref|ZP_07744904.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309367085|gb|EFP94659.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 234

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 85/152 (55%), Gaps = 1/152 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +   +TF   K L+K+ ++  Y + IN   + VI  CA  T+    T
Sbjct: 55  GEPILWWTPTPRAVFDPKTFKPSKSLRKFQKKAQYRVSINLNTDEVIDYCAS-TRCVEET 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           W+N  ++ AY  L   G  H++E W  + L+GGLYGVS+G++F GESMFS   NASK+ L
Sbjct: 114 WLNDDMRSAYKSLAKEGLCHSVEVWDDNTLIGGLYGVSIGSIFCGESMFSLKTNASKVAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
            +  KH       ++D Q + +HL   GA+E+
Sbjct: 174 WYFCKHFNSHMGQIIDCQVMNDHLLSLGALEL 205


>gi|146299355|ref|YP_001193946.1| leucyl/phenylalanyl-tRNA--protein transferase [Flavobacterium
           johnsoniae UW101]
 gi|189046555|sp|A5FJI6|LFTR_FLAJO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|146153773|gb|ABQ04627.1| Leucyl/phenylalanyl-tRNA-transferase [Flavobacterium johnsoniae
           UW101]
          Length = 212

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 93/164 (56%), Gaps = 1/164 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            + I W  P  R ++  +     K ++K + ++++ +  N  F+ VIS C Q K + +  
Sbjct: 48  GEPILWWAPDPRMVLFFDELVISKSMRKILNKKIFKVTYNKNFKEVISNCQQIKREGQNG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI+  + +AY +L   G A ++E W+ +VLVGGLYG+ LG VF GESMFS + NASK  
Sbjct: 108 TWISNEMIEAYCELHKQGIAKSVEVWQDEVLVGGLYGIDLGHVFCGESMFSKVSNASKTA 167

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
              L  +LKK  + LLD Q   +HL   G  EI   ++  +L++
Sbjct: 168 FIALALYLKKENYKLLDCQVYNSHLESLGCREIDREEFMSILKS 211


>gi|119483271|ref|ZP_01618685.1| leucyl/phenylalanyl-tRNA--protein transferase [Lyngbya sp. PCC
           8106]
 gi|119458038|gb|EAW39160.1| leucyl/phenylalanyl-tRNA--protein transferase [Lyngbya sp. PCC
           8106]
          Length = 192

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 96/167 (57%), Gaps = 5/167 (2%)

Query: 6   NSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           + QD+ W    +R +IPL E F  P+ L++ + +  + I +N  F +V+  CA     R 
Sbjct: 23  DDQDLGWYTSRQRALIPLDERFRYPRSLQRVLNQNRFSIAVNRDFSAVVDGCA----NRE 78

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  +Q+ Y  L + GYA++ E W+ D L GG+ G+ +G  F GESMF  +   SK+
Sbjct: 79  VTWISEELQEIYHVLHHAGYAYSFETWQGDELAGGVLGLVIGGAFIGESMFYRIPEGSKV 138

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            +  LV++L++R FLL D Q    HL +FGA  IT  +Y  LL  AL
Sbjct: 139 AMVKLVEYLRERDFLLFDAQMNNPHLERFGAYMITQKEYKNLLAKAL 185


>gi|242279303|ref|YP_002991432.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           salexigens DSM 2638]
 gi|259494483|sp|C6BTW3|LFTR_DESAD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|242122197|gb|ACS79893.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           salexigens DSM 2638]
          Length = 240

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 90/138 (65%), Gaps = 2/138 (1%)

Query: 41  YDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVG 98
           Y +  + AFESVI+ CA+K +  +  TWI   + +AY+ L  +G+ H++E W ++  L G
Sbjct: 84  YTVTFDRAFESVIANCARKFRPGQAGTWILPEMIEAYVKLHKLGFVHSVEVWNREGNLAG 143

Query: 99  GLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
           GLYGVSLG VF GESMF    +ASK+  ++LV+ LK R+F  +D Q  T+HL+  GA E+
Sbjct: 144 GLYGVSLGKVFSGESMFFLEPDASKVGFSYLVQWLKNREFHFVDCQQPTDHLKSLGAEEV 203

Query: 159 THVQYAKLLENALKHPEI 176
           +   +  +L+ AL+HP +
Sbjct: 204 SRELFLDMLDEALEHPAL 221


>gi|330816750|ref|YP_004360455.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           gladioli BSR3]
 gi|327369143|gb|AEA60499.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           gladioli BSR3]
          Length = 247

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 94/176 (53%), Gaps = 6/176 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F      +K +RR L D    IR++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILAPAEFRVSVTFRKTLRRVLRDTRWEIRVDHDFPAVMRACAQAP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L   G+AH+IE W     VGGLYGV+ G +FFGESMF+   
Sbjct: 112 REGQRGTWITDEIVAAYSALHRDGHAHSIETWHDGERVGGLYGVAFGTMFFGESMFAKAS 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY-AKLLENALKHP 174
           +ASKI L  LV HL   Q  ++D Q  T HL   G  EI   ++ A + +N  + P
Sbjct: 172 DASKIALAGLVAHLLAHQVTMIDCQQNTAHLASLGGREIDRREFVAHVRDNVGREP 227


>gi|91788195|ref|YP_549147.1| leucyl/phenylalanyl-tRNA--protein transferase [Polaromonas sp.
           JS666]
 gi|118572939|sp|Q12B43|LFTR_POLSJ RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91697420|gb|ABE44249.1| Leucyltransferase [Polaromonas sp. JS666]
          Length = 255

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 90/166 (54%), Gaps = 5/166 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACA-QKTQ 61
            Q + W  P  R ++  E F   + L+K +   L D    I+ ++AFE VI ACA Q   
Sbjct: 60  GQPVLWWSPDPRMVLHTEKFKLHRSLRKSLIHFLDDPECEIKFDSAFEHVIKACASQPRA 119

Query: 62  KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +P TWI   + +AY  L   GYAH++E W +  LVGGLY V LG + FGESMF+H  +A
Sbjct: 120 GQPGTWIVPDMVQAYSSLHRAGYAHSVETWVRGKLVGGLYCVKLGRMVFGESMFAHQTDA 179

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           SKI L  LV   +  Q  ++D Q  T HL   GA EI    + + L
Sbjct: 180 SKIALAALVGFCRAHQIAMIDCQQNTRHLASLGAAEIDRADFVRHL 225


>gi|157375028|ref|YP_001473628.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella sediminis
           HAW-EB3]
 gi|189046563|sp|A8FUH7|LFTR_SHESH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|157317402|gb|ABV36500.1| Leucyltransferase [Shewanella sediminis HAW-EB3]
          Length = 236

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 90/164 (54%), Gaps = 1/164 (0%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N+ D I W  P  R +    T    + L K ++++ +   IN AF+ V+  CA     + 
Sbjct: 52  NADDPILWWSPDPRAVFVPGTMKASRSLIKSLKKQTWTFTINRAFKEVMIGCAAPRAAQD 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   IQ AY++L   G AH++E W ++ L+GGLYG+++G VF GESMF    NASK 
Sbjct: 112 GTWITQDIQHAYLELHKQGLAHSVEVWDEETLIGGLYGLAIGQVFCGESMFHTQTNASKA 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +  L ++L K+ F L+D Q +  HL   GA  +    +  LL+
Sbjct: 172 AMLVLHQYLLKQGFKLIDAQVVNPHLESLGATALKRKDFINLLK 215


>gi|294649611|ref|ZP_06727028.1| leucyltransferase [Acinetobacter haemolyticus ATCC 19194]
 gi|292824488|gb|EFF83274.1| leucyltransferase [Acinetobacter haemolyticus ATCC 19194]
          Length = 243

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 93/171 (54%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R II    +   K L + +++  Y I IN AFE VI +C+        TW
Sbjct: 52  EPICWWSPEPRCIIEPYAYKPSKSLLRNMKKHDYQITINHAFEDVIRSCSLPRSYADETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  LF  GYA+++E W+++ LVGGLYGVS+G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIQGYCALFNAGYAYSVEVWQQEQLVGGLYGVSIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++     +D Q + +HL   GA  I+   Y K L++ +  P I++
Sbjct: 172 ILMLIGQENHMPWIDCQLVNDHLLSLGASTISRQAYLKSLQDVIIAPPINW 222


>gi|320104033|ref|YP_004179624.1| leucyl/phenylalanyl-tRNA/protein transferase [Isosphaera pallida
           ATCC 43644]
 gi|319751315|gb|ADV63075.1| leucyl/phenylalanyl-tRNA/protein transferase [Isosphaera pallida
           ATCC 43644]
          Length = 239

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           SAN     W  P  R I+  E F   ++     R+  + I+ +T F  V+  CA   +K 
Sbjct: 53  SANPTP-RWYSPHPRMILQPERFRLTRKAAALERKRPFQIKADTDFIGVMRGCATMRRKH 111

Query: 64  P-TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
              TWI   + +AY +L   GYAH++EAWK   LVGG+YG+ LGA FFGESMF   +NAS
Sbjct: 112 EFGTWICSAMLEAYAELHRRGYAHSVEAWKDGRLVGGIYGLHLGACFFGESMFHTEDNAS 171

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           K+ L  L++  +   +L LD Q  + H+   G + ++   Y  LL   +  P
Sbjct: 172 KLALAALMRRGRAEGWLFLDAQVPSPHIEAHGGLLVSRSTYLSLLREGVSQP 223


>gi|226951224|ref|ZP_03821688.1| leucyl, phenylalanyl-tRNA-protein transferase [Acinetobacter sp.
           ATCC 27244]
 gi|226838018|gb|EEH70401.1| leucyl, phenylalanyl-tRNA-protein transferase [Acinetobacter sp.
           ATCC 27244]
          Length = 243

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 93/171 (54%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R II    +   K L + +++  Y I IN AF+ VI +C+        TW
Sbjct: 52  EPICWWSPEPRCIIEPHAYKPSKSLLRNMKKHDYQITINHAFKDVIRSCSLPRSYADETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  LF  GYA+++E W+++ LVGGLYGVS+G   FGESMFS   + SK+   
Sbjct: 112 ISQDIIQGYCALFNAGYAYSVEVWQQEQLVGGLYGVSIGKGCFGESMFSTQTDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++     +D Q + +HL   GA  I+   Y K L++ +  P I++
Sbjct: 172 TLMLIGQENHMPWIDCQLVNDHLLSLGASTISRQAYLKSLQDVIIAPPINW 222


>gi|17231459|ref|NP_488007.1| leucyl/phenylalanyl-tRNA--protein transferase [Nostoc sp. PCC 7120]
 gi|33301311|sp|Q8YQ68|LFTR_ANASP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|17133101|dbj|BAB75666.1| leucyl/phenylalanyl-tRNA-protein transferase [Nostoc sp. PCC 7120]
          Length = 191

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 101/175 (57%), Gaps = 7/175 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +   + W     R +IPL E F  PK L++ + +E + + IN  F +V++ CA  
Sbjct: 19  MADDNDC--LGWYGSRDRTLIPLDERFRYPKSLQRVLNQERFTVAINRDFAAVVAGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R +TWI+  +Q+ Y  L+  GYA++ E W+ + L GG+ G+ +G  F GESMF  + 
Sbjct: 75  --NRESTWISQELQEIYRLLYQTGYAYSFETWQGEELAGGILGIVIGGAFIGESMFYRIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             SK+ +  LV+ L++R+F++ D Q +  HL +FGA  I   +Y  LLE AL  P
Sbjct: 133 EGSKVAMVKLVERLRQREFVMFDAQMMNPHLERFGAYRIKDKEYKTLLEKALLSP 187


>gi|262373239|ref|ZP_06066518.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter junii
           SH205]
 gi|262313264|gb|EEY94349.1| leucyl/phenylalanyl-tRNA-protein transferase [Acinetobacter junii
           SH205]
          Length = 243

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 93/171 (54%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R II  + +   K L + +++  Y I IN AFE VI AC+        TW
Sbjct: 52  EPICWWSPEPRCIIEPDAYKPSKSLLRNMKKHDYRITINHAFEQVIRACSLPRSYANETW 111

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I+  I + Y  LF  GYA+++E W  + LVGGLYGV++G   FGESMFS   + SK+   
Sbjct: 112 ISEDIIEGYSALFKAGYAYSVEVWNNEQLVGGLYGVTIGKGCFGESMFSTETDVSKMAFY 171

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
            L+   ++ Q   +D Q + +HL   GA  ++   Y K L++ +  P I++
Sbjct: 172 TLMLIGQENQLPWIDCQLVNDHLLSLGARTLSRQAYLKSLQDVIITPSINW 222


>gi|146329399|ref|YP_001209589.1| leucyl/phenylalanyl-tRNA--protein transferase [Dichelobacter
           nodosus VCS1703A]
 gi|146232869|gb|ABQ13847.1| leucyl-phenylalanyl-tRNA--protein transferase [Dichelobacter
           nodosus VCS1703A]
          Length = 226

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 86/160 (53%), Gaps = 3/160 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +IP +  H  + L K +R   Y I ++  F + I  CA+   K   TWI 
Sbjct: 46  ILWWAPDPRCVIPTDRAHLSRSLGKTLRDPDYRITLDMDFAATIDHCARLHGK---TWIT 102

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I+K Y  L   G AH+ E W+   L+GG+YGV L  +F GESMFS  ++ASKI L  L
Sbjct: 103 PLIRKTYTRLHQHGLAHSCELWRGQELIGGMYGVGLDKIFCGESMFSVQKSASKIVLLWL 162

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
             +L +   LLLD QF+T HL   GA+EI   +Y   L  
Sbjct: 163 CAYLAEHGVLLLDTQFMTPHLMSMGAVEIPRQRYQTYLSE 202


>gi|119476165|ref|ZP_01616517.1| leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2143]
 gi|119450792|gb|EAW32026.1| leucyl/phenylalanyl-tRNA--protein transferase [marine gamma
           proteobacterium HTCC2143]
          Length = 257

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 95/167 (56%), Gaps = 1/167 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPT 65
           +Q I W  P  R ++     H  K LKK +R++ +++  +  F  V+  CAQ +++ +  
Sbjct: 72  NQPILWWSPSPRAVLFPPQVHISKSLKKRLRQQAFNVTGDHHFSLVVEHCAQVSRRGQDG 131

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +  AY  L  MG AH++E W +  L GGLYG+++G VFFGESMFS + +ASKI 
Sbjct: 132 TWITDEMLDAYSLLHDMGIAHSVEVWHQGQLAGGLYGLAIGGVFFGESMFSLVSDASKIA 191

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
              L   L++  F ++D Q    HL   GA EI   ++ +LL + ++
Sbjct: 192 FFALCNQLQQWGFAVIDCQVTNPHLLSLGAEEIDRSRFNQLLSSNIE 238


>gi|319952607|ref|YP_004163874.1| leucyl/phenylalanyl-tRNA--protein transferase [Cellulophaga
           algicola DSM 14237]
 gi|319421267|gb|ADV48376.1| Leucyl/phenylalanyl-tRNA--protein transferase [Cellulophaga
           algicola DSM 14237]
          Length = 209

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 88/159 (55%), Gaps = 1/159 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R ++     +  K ++K I+   + +  N  F++V+  C+   +K +  TWI
Sbjct: 51  ILWWSPDPRMVLFPHKINISKSMRKVIKDRQFTLTKNVDFKTVLEYCSMVDRKDQDGTWI 110

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +++AY+ L   G AH+ E W+KD LVGGLYG+ LG VF GESMFS + NASK     
Sbjct: 111 TEKMKEAYLKLHEKGIAHSYEVWEKDTLVGGLYGIDLGHVFCGESMFSLVSNASKFAFIS 170

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           L K L  + + L+D Q  T HL   GA EI    + KLL
Sbjct: 171 LAKELAIKNYTLIDCQVYTEHLESLGAEEIAREDFVKLL 209


>gi|298530332|ref|ZP_07017734.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509706|gb|EFI33610.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 244

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 1/156 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
                I W  P  R ++   + H P+ L++ +    + I  + AFE VI  CA  K    
Sbjct: 48  GPGSPILWWSPDPRLVLFPGSLHIPRSLRRVLNSGKFTITADQAFEKVIEYCAGIKRAGG 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TW+   +  AYI L +MG AH++EAW +  L GG+YG++LG++FFGESMF  + +ASK
Sbjct: 108 HGTWLVPEMISAYIRLHHMGIAHSVEAWHRGQLAGGIYGLALGSIFFGESMFYRVPDASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
             L +L + ++ + +LL+D Q  T H+ +FGA E++
Sbjct: 168 TALVYLCRIMQNKGYLLMDCQQTTRHMLRFGAQEVS 203


>gi|260772642|ref|ZP_05881558.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio metschnikovii
           CIP 69.14]
 gi|260611781|gb|EEX36984.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio metschnikovii
           CIP 69.14]
          Length = 244

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT- 65
            + I W  P  R +   +TF   K ++K+ R+ +Y + +N     VI  CA     RPT 
Sbjct: 55  GEPILWWSPSPRAVFFPKTFKPAKSVQKFQRKHIYRVSLNHDTARVIELCAAV---RPTE 111

Query: 66  -TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TW+N  ++ +Y  L   G  H++E W+ D LVGGLYG+ +G +F GESMFS  +NASKI
Sbjct: 112 QTWLNADMRSSYQQLAKQGVCHSVEVWRDDTLVGGLYGIQVGQLFCGESMFSLADNASKI 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
              +   H  +    L+D Q +  HLR  GA+E+   Q+
Sbjct: 172 GFWYFCVHFARCGGQLIDCQVMNPHLRSLGAVELPRDQF 210


>gi|148652430|ref|YP_001279523.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychrobacter sp.
           PRwf-1]
 gi|148571514|gb|ABQ93573.1| Leucyltransferase [Psychrobacter sp. PRwf-1]
          Length = 269

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 84/149 (56%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I+W  P  R ++  ++F   K L++  +   +   +N+ FESVI AC+        T
Sbjct: 76  DEPIAWWCPEPRCVLAPDSFVPSKSLQRLAKNSQWQWSVNSDFESVIHACSLPRSYAKDT 135

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI+  + +AY  L  +GYAH+IE W+   L+GGLYG+ +G ++FGESMF H  NASK+  
Sbjct: 136 WIHDEMIEAYCQLHQLGYAHSIEVWEDKQLIGGLYGLKIGQIYFGESMFHHKSNASKVAF 195

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGA 155
             L +  +  Q  L+D Q    HL+  GA
Sbjct: 196 WALTQFCQYTQVQLIDCQLPNPHLQSLGA 224


>gi|153827999|ref|ZP_01980666.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           623-39]
 gi|148876580|gb|EDL74715.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           623-39]
          Length = 243

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQDEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|261344319|ref|ZP_05971963.1| leucyltransferase [Providencia rustigianii DSM 4541]
 gi|282567924|gb|EFB73459.1| leucyltransferase [Providencia rustigianii DSM 4541]
          Length = 239

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 86/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++ +   H  + +KK +++  Y I IN AF+ VI ACA + +    TWI  +
Sbjct: 56  WWSPDPRAVLKVGDLHISRSMKKTLKKSPYRITINHAFQQVIEACAIRAE---GTWILPS 112

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           ++  YI L   G AH+IEAW  D LVGGLYGV++G +F GESMFS M +ASK        
Sbjct: 113 VRAGYIALHEEGIAHSIEAWHGDKLVGGLYGVNVGHLFCGESMFSRMNDASKCAFITFYF 172

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GA EI+   +  +L
Sbjct: 173 HFLRYNGQLFDCQVLNHHTASLGAKEISRRDFLHIL 208


>gi|50121576|ref|YP_050743.1| leucyl/phenylalanyl-tRNA--protein transferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|49612102|emb|CAG75552.1| leucyl/phenylalanyl-tRNA--protein transferase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 237

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 86/161 (53%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++     H  + +KK+++R  +   +N AF+ VI ACAQ+      T
Sbjct: 56  GEPILWWSPNPRAVLLPGELHLSRSMKKFLKRHTFHATLNQAFDDVIHACAQEHHD--GT 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AY  L  +G AH++E W    LVGGLYG+  G +F GESMFS M+NASK  L
Sbjct: 114 WITPDIISAYRQLHQVGKAHSVEVWHNGALVGGLYGIEQGRLFCGESMFSRMDNASKYAL 173

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +H  +    L+D Q + +H    G  EI  V++ + L
Sbjct: 174 LAFQQHFIRHGGHLIDCQVLNSHTASLGVSEIPRVRFLQQL 214


>gi|61213409|sp|Q6D3U2|LFTR_ERWCT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 234

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 86/161 (53%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++     H  + +KK+++R  +   +N AF+ VI ACAQ+      T
Sbjct: 53  GEPILWWSPNPRAVLLPGELHLSRSMKKFLKRHTFHATLNQAFDDVIHACAQEHHD--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AY  L  +G AH++E W    LVGGLYG+  G +F GESMFS M+NASK  L
Sbjct: 111 WITPDIISAYRQLHQVGKAHSVEVWHNGALVGGLYGIEQGRLFCGESMFSRMDNASKYAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +H  +    L+D Q + +H    G  EI  V++ + L
Sbjct: 171 LAFQQHFIRHGGHLIDCQVLNSHTASLGVSEIPRVRFLQQL 211


>gi|85712411|ref|ZP_01043461.1| Leu/Phe-tRNA-protein transferase [Idiomarina baltica OS145]
 gi|85693854|gb|EAQ31802.1| Leu/Phe-tRNA-protein transferase [Idiomarina baltica OS145]
          Length = 234

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 85/163 (52%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           A    I W  P  R +      H  + LKK +RR+ + + +N AFE VI  CA    +  
Sbjct: 50  AADDPILWWSPNPRAVFVPGDIHCSRSLKKAMRRQPWRVTLNRAFEEVIDECATIRAEHE 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +++AYI+L   G+AH++E W  + LVGGLYGVS+G +F GESMF    NASK+
Sbjct: 110 GTWITEPMREAYIELHRKGHAHSVEVWLDNSLVGGLYGVSVGRLFCGESMFHRATNASKV 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L        +    L+D Q    HL   GA+ +    + + L
Sbjct: 170 ALHCFANAFVEHGGQLIDCQMENPHLTSLGAVPMAREHFLEQL 212


>gi|303245549|ref|ZP_07331833.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           fructosovorans JJ]
 gi|302493398|gb|EFL53260.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           fructosovorans JJ]
          Length = 236

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 87/162 (53%), Gaps = 1/162 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R I+     H  +RL + IR   + + ++  F  VI  CA  ++     TWI
Sbjct: 54  ILWWSPDPRPILFPGLIHVSRRLARTIRSGKFTVTLDEDFSGVIRGCAGVSRTVGDGTWI 113

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AY  L   GYAH++EAW    LVGG YGV++G  FFGESMF  + +ASK+    
Sbjct: 114 VPEMIAAYEALHAAGYAHSVEAWLGGELVGGAYGVTIGRAFFGESMFHKVADASKVAFVT 173

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           L +HL  R F  +D Q  T HL +FGA+ +   ++ K L+ A
Sbjct: 174 LCRHLDGRGFHFIDCQQETGHLARFGAVPVRRSEFQKRLDVA 215


>gi|209525880|ref|ZP_03274415.1| leucyl/phenylalanyl-tRNA/protein transferase [Arthrospira maxima
           CS-328]
 gi|209493689|gb|EDZ94009.1| leucyl/phenylalanyl-tRNA/protein transferase [Arthrospira maxima
           CS-328]
          Length = 192

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 99/164 (60%), Gaps = 5/164 (3%)

Query: 10  ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           + W    +R +IPL E F  P+ L++++ +  + + IN  F++V+  CA     R  TWI
Sbjct: 27  LGWYSSHQRALIPLDERFRYPRSLQRFLNQNRFQVAINGDFDAVVEGCA----DRENTWI 82

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +  +++ Y  L   G+AH+ E W+ D L GG+ G+++G  F GESMF ++ N SK+ +  
Sbjct: 83  SAELKRIYQVLNRQGWAHSFETWEGDRLAGGILGIAIGGAFIGESMFFNIPNGSKVAMVK 142

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           LV+HL+KR+F L D Q    HL +FGA  ++  QY +LL  ALK
Sbjct: 143 LVEHLQKREFCLFDAQMNNPHLERFGAFIVSKKQYNQLLSKALK 186


>gi|34556773|ref|NP_906588.1| leucyl/phenylalanyl-tRNA--protein transferase [Wolinella
           succinogenes DSM 1740]
 gi|47115702|sp|Q7MAC4|LFTR_WOLSU RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|34482487|emb|CAE09488.1| LEUCYL/PHENYLALANYL-TRNA--PROTEIN TRANSFERASE [Wolinella
           succinogenes]
          Length = 226

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 99/170 (58%), Gaps = 2/170 (1%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           N+ D I W  P  R ++        +R +K + +  +++R +  F+ VI  C +  +K +
Sbjct: 47  NAGDPILWWSPHPRFLLFPSELQFSRRTQKRLEQCAFEVRADERFKEVIGGCQKAVRKNQ 106

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   I KAY  LF  GYAH++E +K+  LVGGLYGVSLGA FFGESMFS  ++ASK
Sbjct: 107 EGTWILPKIVKAYEHLFEEGYAHSLEVYKEGELVGGLYGVSLGAAFFGESMFSRQDHASK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             +  L +   +R + ++D Q  + HL ++GA  +   ++  LL+ ALK 
Sbjct: 167 AAIRELCRLGVERGWKMIDCQIHSEHLERWGARAVDRERFLVLLKEALKE 216


>gi|261211854|ref|ZP_05926141.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. RC341]
 gi|260839204|gb|EEX65836.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. RC341]
          Length = 245

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K ++K+ R+  Y I +N A  +VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPAQFQPAKSVRKFQRQHQYRISLNLATSNVIELCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 SQMRHAYGELAKQGRCHSVEVWQNEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLKSLGATTLSREQFIQSL 214


>gi|153802163|ref|ZP_01956749.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           MZO-3]
 gi|229523823|ref|ZP_04413228.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae bv.
           albensis VL426]
 gi|254224878|ref|ZP_04918493.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae V51]
 gi|254285321|ref|ZP_04960286.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           AM-19226]
 gi|297579314|ref|ZP_06941242.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae
           RC385]
 gi|124122298|gb|EAY41041.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           MZO-3]
 gi|125622566|gb|EAZ50885.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae V51]
 gi|150424593|gb|EDN16529.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           AM-19226]
 gi|229337404|gb|EEO02421.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae bv.
           albensis VL426]
 gi|297536908|gb|EFH75741.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae
           RC385]
          Length = 243

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|310767163|gb|ADP12113.1| leucyl/phenylalanyl-tRNA--protein transferase [Erwinia sp. Ejp617]
          Length = 230

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 91/170 (53%), Gaps = 2/170 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++   I W  P  R I+  + FH  + +K++ +   Y + +N  F  VI  CA   Q+  
Sbjct: 51  SSGDPILWWSPDPRAILLPQHFHLSRSMKRFHQHSSYRVTLNQRFREVIEGCACDRQE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++ A+  L  +G+AH++E W  D LVGG+YG++LG +F GESMFS  ENASK 
Sbjct: 109 GTWITHEVKHAWQRLHALGHAHSVEVWHGDELVGGMYGLALGQIFCGESMFSRRENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L     +  ++   L+D Q +  H R  GA EI+   Y + + +    P
Sbjct: 169 ALLVFCHYFLQQGGKLIDCQVLNPHTRSLGAQEISRASYLEYVSSLAFQP 218


>gi|229520667|ref|ZP_04410090.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae TM
           11079-80]
 gi|229342222|gb|EEO07217.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae TM
           11079-80]
          Length = 243

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 86/158 (54%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSMKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  +   Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTLNREQFIQSL 214


>gi|121727941|ref|ZP_01680989.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae V52]
 gi|147674281|ref|YP_001217280.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           O395]
 gi|262169739|ref|ZP_06037430.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           RC27]
 gi|172047664|sp|A5F7F1|LFTR_VIBC3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|121629791|gb|EAX62207.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae V52]
 gi|146316164|gb|ABQ20703.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           O395]
 gi|227013638|gb|ACP09848.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae O395]
 gi|262021973|gb|EEY40683.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           RC27]
          Length = 243

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|15641739|ref|NP_231371.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121585804|ref|ZP_01675598.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           2740-80]
 gi|153819052|ref|ZP_01971719.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae NCTC
           8457]
 gi|153822786|ref|ZP_01975453.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae B33]
 gi|227081883|ref|YP_002810434.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae
           M66-2]
 gi|229508158|ref|ZP_04397663.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae BX
           330286]
 gi|229511603|ref|ZP_04401082.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae B33]
 gi|229518742|ref|ZP_04408185.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae RC9]
 gi|229607733|ref|YP_002878381.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           MJ-1236]
 gi|254848851|ref|ZP_05238201.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae MO10]
 gi|255744845|ref|ZP_05418795.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholera CIRS
           101]
 gi|262161873|ref|ZP_06030891.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           INDRE 91/1]
 gi|298498190|ref|ZP_07007997.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae MAK
           757]
 gi|33301331|sp|Q9KRA7|LFTR_VIBCH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|254809173|sp|C3LN57|LFTR_VIBCM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|9656256|gb|AAF94885.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121549942|gb|EAX59960.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           2740-80]
 gi|126510384|gb|EAZ72978.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae NCTC
           8457]
 gi|126519692|gb|EAZ76915.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae B33]
 gi|227009771|gb|ACP05983.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae
           M66-2]
 gi|229343431|gb|EEO08406.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae RC9]
 gi|229351568|gb|EEO16509.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae B33]
 gi|229355663|gb|EEO20584.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae BX
           330286]
 gi|229370388|gb|ACQ60811.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           MJ-1236]
 gi|254844556|gb|EET22970.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae MO10]
 gi|255737316|gb|EET92711.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholera CIRS
           101]
 gi|262028605|gb|EEY47260.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           INDRE 91/1]
 gi|297542523|gb|EFH78573.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae MAK
           757]
          Length = 243

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|188534286|ref|YP_001908083.1| leucyl/phenylalanyl-tRNA--protein transferase [Erwinia tasmaniensis
           Et1/99]
 gi|226737697|sp|B2VC63|LFTR_ERWT9 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|188029328|emb|CAO97205.1| Leucyl, phenylalanyl-tRNA-protein transferase [Erwinia tasmaniensis
           Et1/99]
          Length = 230

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 91/170 (53%), Gaps = 2/170 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           A    I W  P  R I+  + FH  + +K++ ++  Y + +N  F  VI  CA   Q+  
Sbjct: 51  AAGDPILWWSPDPRAILLPQHFHLSRSMKRFHQKSPYRVTLNQRFRQVIEGCASDRQE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   ++ A+  L  +G+AH+IE W+ + LVGG+YG++LG +F GESMFS  ENASK 
Sbjct: 109 GTWITYEVKLAWQRLHELGHAHSIEVWQDEELVGGMYGLALGQIFCGESMFSQGENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            L    ++  ++   L+D Q +  H +  GA EI    Y   L +    P
Sbjct: 169 ALLVFSRYFLQQGGKLIDCQVLNPHTQSLGAQEIPRASYLSYLHSLAFRP 218


>gi|295096407|emb|CBK85497.1| leucyl/phenylalanyl-tRNA--protein transferase [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 234

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 85/163 (52%), Gaps = 2/163 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++    FH  + +K++  +  + + +N AF  VI  CA+   +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPGQFHLSRSMKRFHAKSPFRVTLNHAFGQVIEGCAEDRHE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I  AY  L  +GYAH+IE W  D LVGG+YGV+ G +F GESMFS   NASK  L   
Sbjct: 114 RDIIIAYHQLHELGYAHSIEVWSGDDLVGGMYGVAQGTLFCGESMFSRATNASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
                +R   L+D Q +  H    GA+EI+   Y + LE   K
Sbjct: 174 SLEFARRGGQLMDCQVLNEHTASLGAVEISRRHYIEHLEQCRK 216


>gi|95930479|ref|ZP_01313215.1| Leucyltransferase [Desulfuromonas acetoxidans DSM 684]
 gi|95133519|gb|EAT15182.1| Leucyltransferase [Desulfuromonas acetoxidans DSM 684]
          Length = 240

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R I+     H  +RL K  R+  + +  +  FE+ I  CA   ++  +TWI+  
Sbjct: 55  WWSPDPRCILEPRDLHIARRLAKKQRQGHFTLTFDRDFETCIHHCATADERGESTWISPE 114

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           I  AYI+L  +GYAH++E W +  +VGGLYG+++G  F GESMF  + +ASK+    LV+
Sbjct: 115 IMSAYIELHRLGYAHSVECWLEGEMVGGLYGLAIGRCFCGESMFHRVTDASKLAFIALVQ 174

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQY------AKLLENALKHP 174
            L    + ++D Q  T HL   GA +I+   +       +L EN L  P
Sbjct: 175 ALCPLGYRMIDCQLPTEHLHSLGAKDISRDDFLSRLDQCELWENGLVVP 223


>gi|86135051|ref|ZP_01053633.1| Leu/Phe-tRNA-protein transferase [Polaribacter sp. MED152]
 gi|85821914|gb|EAQ43061.1| Leu/Phe-tRNA-protein transferase [Polaribacter sp. MED152]
          Length = 210

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 92/166 (55%), Gaps = 4/166 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  PL+R ++  +     K +++ I +  + I  N  FE VI  C    +   
Sbjct: 46  SEDEPIVWYCPLKRMVLYPDHLRISKSMRRLINKGTFTITENKNFEEVIYNCKNIDRNDG 105

Query: 65  -TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +++AYI+L   G A +IE W+ DVLVGGLYG+ +  +F GESMFS + NASK
Sbjct: 106 LGTWITNEMEQAYINLHKKGIAKSIEVWQNDVLVGGLYGLEINDIFCGESMFSKVSNASK 165

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           I   +LV   KK  + L+D Q   +HL   GA EI    + K+L+N
Sbjct: 166 IAFIYLV---KKSSYKLIDCQVYNSHLASLGAKEIERATFLKVLKN 208


>gi|323693041|ref|ZP_08107261.1| leucyl/phenylalanyl-tRNA-protein transferase [Clostridium symbiosum
           WAL-14673]
 gi|323502922|gb|EGB18764.1| leucyl/phenylalanyl-tRNA-protein transferase [Clostridium symbiosum
           WAL-14673]
          Length = 220

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 88/169 (52%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
             +I W  P  R +I     H  + +KKY+ +    I +N  F   +  C  K ++   T
Sbjct: 51  GDEILWWCPKERFLIFPGEIHVSRSMKKYMNKHDSKICLNRDFRDTMHRCRMKREQEEGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +++AY  +   G+A ++EA+    L GGLYGVS+G  FFGESMFS  EN SK+ L
Sbjct: 111 WITDEMEEAYYRMNQNGWAVSVEAFVDGELAGGLYGVSIGKCFFGESMFSERENGSKVAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
             L K L++  +L +D QF T HL   G   +   +Y ++LE      E
Sbjct: 171 IALAKILEENGYLFIDCQFHTEHLESMGGRYVPWEEYNQMLEEGTNRSE 219


>gi|116326893|ref|YP_796613.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116329875|ref|YP_799593.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|122282351|sp|Q04W85|LFTR_LEPBJ RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|122285257|sp|Q056R5|LFTR_LEPBL RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|116119637|gb|ABJ77680.1| Leucyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116123564|gb|ABJ74835.1| Leucyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 219

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 93/167 (55%), Gaps = 3/167 (1%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W     RGI  L   H  KRLK+ I ++ Y I  N AFE V+  CA +  +   
Sbjct: 42  SDQPILWYCLDPRGIFDLNKLHISKRLKRKINQKRYTITFNRAFEQVMRCCAYRPGEE-- 99

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASKI 124
           TWI     K+Y +   +GYAH+IE W ++  L GG+YGV++G  F GESMFS + +  KI
Sbjct: 100 TWITDLFIKSYTEFHKLGYAHSIEVWDENGNLGGGVYGVAIGNFFAGESMFSFISDFGKI 159

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            L HL + LKK QF L D Q +       GA +I   +Y + LE+A+
Sbjct: 160 GLFHLFEALKKDQFTLFDTQQLNIVTLCLGAYQIPKKEYLRRLESAV 206


>gi|294625256|ref|ZP_06703895.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294666596|ref|ZP_06731835.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292600430|gb|EFF44528.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292603616|gb|EFF47028.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 249

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 83/152 (54%), Gaps = 1/152 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  Q I W  P  R +   +      R ++ +R   + +R +TAFE VI ACA   +  +
Sbjct: 55  SQGQPILWWSPDPRMVFRTDALRLSSRFRRQLRSSSWTVRADTAFEQVIDACASVPRAGQ 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q+AYI L  +G+AH++E +    LVGG+YGV++G +FFGESMFS     SK
Sbjct: 115 DGTWITAQMQQAYIALHELGHAHSLEVFDGTRLVGGIYGVAIGQMFFGESMFSAQSGGSK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
           + L  L  HL    + LLD Q    HL   GA
Sbjct: 175 VALAALAMHLHTEGWPLLDAQVENPHLLSLGA 206


>gi|194365705|ref|YP_002028315.1| leucyl/phenylalanyl-tRNA--protein transferase [Stenotrophomonas
           maltophilia R551-3]
 gi|194348509|gb|ACF51632.1| leucyl/phenylalanyl-tRNA/protein transferase [Stenotrophomonas
           maltophilia R551-3]
          Length = 246

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 92/166 (55%), Gaps = 4/166 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  + I W  P  R +   +  H   R ++ +R   ++I ++TAF  V+ ACA   +  +
Sbjct: 55  SEGEPILWWSPDPRMVFRTDGVHLSSRFRRQLRSSTWEISVDTAFGRVMRACAAAPRPGQ 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  + +AY  L  +G+AH+ E W +  LVGG+YGV++GA+FFGESMFS     SK
Sbjct: 115 DGTWISPAMVEAYSQLHDLGFAHSFEVWDRQTLVGGIYGVAIGAMFFGESMFSGASGGSK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           I L  L   L+   + L+D Q    HL + GA    H+  A+ L++
Sbjct: 175 IALAALATTLRDWGWQLIDAQVENPHLLRMGA---EHLPRAEFLDH 217


>gi|21242747|ref|NP_642329.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|33301302|sp|Q8PL03|LFTR_XANAC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|21108225|gb|AAM36865.1| leucyl-phenylalanyl-tRNA-protein transferase [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 249

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 83/152 (54%), Gaps = 1/152 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  Q I W  P  R +   +      R ++ +R   + +R +TAFE VI ACA   +  +
Sbjct: 55  SQDQPILWWSPDPRMVFRTDALRLSSRFRRQLRSSSWTVRADTAFEQVIDACASVPRAGQ 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q+AYI L  +G+AH++E +    LVGG+YGV++G +FFGESMFS     SK
Sbjct: 115 DGTWITAQMQQAYIALHELGHAHSLEVFDGTRLVGGIYGVAIGQMFFGESMFSAQSGGSK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
           + L  L  HL    + LLD Q    HL   GA
Sbjct: 175 VALAALAMHLHTEGWPLLDAQVENPHLLSLGA 206


>gi|323485965|ref|ZP_08091297.1| leucyl/phenylalanyl-tRNA-protein transferase [Clostridium symbiosum
           WAL-14163]
 gi|323400727|gb|EGA93093.1| leucyl/phenylalanyl-tRNA-protein transferase [Clostridium symbiosum
           WAL-14163]
          Length = 220

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 88/169 (52%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
             +I W  P  R +I     H  + +KKY+ +    I +N  F   +  C  K ++   T
Sbjct: 51  GDEILWWCPKERFLIFPGEIHVSRSMKKYMNKHDSKICLNRDFRDTMHRCRMKREQEEGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +++AY  +   G+A ++EA+    L GGLYGVS+G  FFGESMFS  EN SK+ L
Sbjct: 111 WITDEMEEAYYRMNQNGWAVSVEAFVDGELAGGLYGVSIGKCFFGESMFSERENGSKVAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
             L K L++  +L +D QF T HL   G   +   +Y ++LE      E
Sbjct: 171 IALAKILEENGYLFIDCQFHTEHLESMGGRYVPWEEYNQMLEEGTDRSE 219


>gi|153826227|ref|ZP_01978894.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           MZO-2]
 gi|229529239|ref|ZP_04418629.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           12129(1)]
 gi|149739992|gb|EDM54167.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           MZO-2]
 gi|229333013|gb|EEN98499.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           12129(1)]
 gi|327484329|gb|AEA78736.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           LMA3894-4]
          Length = 243

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 86/158 (54%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  +   Q+ + L
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTLNREQFIQSL 214


>gi|227329566|ref|ZP_03833590.1| leucyl/phenylalanyl-tRNA--protein transferase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 234

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 85/161 (52%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++    FH  + +KK+++R  +   +N AF+ VI ACA +      T
Sbjct: 53  GEPILWWSPNPRAVLFPSEFHLSRSMKKFLKRHTFHATLNQAFDDVIHACAHEHHD--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AY  L  +G AH++E W    LVGGLYG+  G +F GESMFS M+NASK  L
Sbjct: 111 WITPDIISAYRQLHQVGKAHSVEVWHNGALVGGLYGIEQGRLFCGESMFSRMDNASKYAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +H  +    L+D Q +  H    G  EI   ++ +LL
Sbjct: 171 LAFQQHFIRHGGHLIDCQVLNAHTASLGVSEIPRERFLQLL 211


>gi|218439770|ref|YP_002378099.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp. PCC
           7424]
 gi|226736122|sp|B7K8N3|LFTR_CYAP7 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|218172498|gb|ACK71231.1| leucyl/phenylalanyl-tRNA/protein transferase [Cyanothece sp. PCC
           7424]
          Length = 191

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 97/173 (56%), Gaps = 7/173 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           M+D   +  + W    +R +IPL+  F  PK L++ + +E + + IN  F +V   CA  
Sbjct: 19  MSDEEGT--LGWYTSSQRTLIPLDDRFRYPKSLQRVLNQERFTVAINRDFPAVCWGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  + + Y+ L   G+A + E W+ + L GG+ G+++   F GESMF ++ 
Sbjct: 75  --NRETTWISHELIEIYLQLNQAGWAFSFETWQGNQLAGGILGIAIRGAFIGESMFYNIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           + SK+ +  LV+HL+ R F+L D Q    HL +FG+  I+  +Y  LL  AL 
Sbjct: 133 DGSKVAMVKLVEHLRARGFVLFDAQLQNPHLARFGSYGISDREYKLLLRKALS 185


>gi|259908935|ref|YP_002649291.1| leucyl/phenylalanyl-tRNA--protein transferase [Erwinia pyrifoliae
           Ep1/96]
 gi|224964557|emb|CAX56069.1| Leucyl, phenylalanyl-tRNA-protein transferase [Erwinia pyrifoliae
           Ep1/96]
 gi|283478937|emb|CAY74853.1| leucyl, phenylalanyl-tRNA-protein transferase [Erwinia pyrifoliae
           DSM 12163]
          Length = 230

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 89/165 (53%), Gaps = 2/165 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R I+  + FH  + +K++ +   Y + +N  F  VI  CA   Q+   TWI 
Sbjct: 56  ILWWSPDPRAILLPQHFHLSRSMKRFHQHSSYRVTLNQRFREVIEGCACDRQE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ A+  L  +G+AH++E W  D LVGG+YG++LG +F GESMFS  ENASK  L   
Sbjct: 114 HEVKHAWQRLHALGHAHSVEVWHGDELVGGMYGLALGQIFCGESMFSRRENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             +  ++   L+D Q +  H R  GA EI+   Y + + +    P
Sbjct: 174 CHYFLQQGGKLIDCQVLNPHTRSLGAQEISRASYLEYVSSLAFQP 218


>gi|238789628|ref|ZP_04633411.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           frederiksenii ATCC 33641]
 gi|238722181|gb|EEQ13838.1| Leucyl/phenylalanyl-tRNA--protein transferase [Yersinia
           frederiksenii ATCC 33641]
          Length = 159

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 80/127 (62%), Gaps = 2/127 (1%)

Query: 32  LKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAW 91
           +++++RR  Y   +N AF+ V+SACA  +Q+   TWI   +Q+AY  L  +G+AH++E W
Sbjct: 1   MRRFLRRCPYHFTLNHAFKDVVSACA--SQRDEGTWIGDDVQRAYCQLHALGHAHSVEVW 58

Query: 92  KKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLR 151
            ++ LVGGLYG+++G++F GESMFS  +NASK  L     H       L+D Q +  H  
Sbjct: 59  LENELVGGLYGIAVGSLFCGESMFSRADNASKSALMVFCHHFTHHGGELIDCQVLNAHTA 118

Query: 152 QFGAIEI 158
             GAIEI
Sbjct: 119 SLGAIEI 125


>gi|242239691|ref|YP_002987872.1| leucyl/phenylalanyl-tRNA/protein transferase [Dickeya dadantii
           Ech703]
 gi|242131748|gb|ACS86050.1| leucyl/phenylalanyl-tRNA/protein transferase [Dickeya dadantii
           Ech703]
          Length = 238

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 93/174 (53%), Gaps = 10/174 (5%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +KK++R   Y + +N +F  VI+ACA   ++   TWI+
Sbjct: 56  ILWWSPDPRAVLFPEQFHLSRSMKKFMRHTRYRVTLNQSFTEVITACA--NERDDGTWIS 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I +AY+ L    +AH++E W    LVGGLYG++ G++F GESMFS  +NASK  LT  
Sbjct: 114 DDIIEAYLYLHQSTHAHSVEVWDDGQLVGGLYGIAQGSLFCGESMFSRADNASKFALTAF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITH-------VQY-AKLLENALKHPE 175
           + H       L+D Q +  H    GA EI          QY  + L NA   P+
Sbjct: 174 LYHFVGYGGRLIDCQVLNPHTASLGATEIPRRDFLYRLAQYRTQSLGNACWQPQ 227


>gi|124266662|ref|YP_001020666.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylibium
           petroleiphilum PM1]
 gi|158512860|sp|A2SFU2|LFTR_METPP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|124259437|gb|ABM94431.1| Leucyltransferase [Methylibium petroleiphilum PM1]
          Length = 265

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 86/157 (54%), Gaps = 5/157 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKTQK 62
            Q + W  P  R ++P+  F     L+K +RR       ++RI+  F +VI ACA   ++
Sbjct: 55  GQPVLWWSPDPRMVLPVAEFKLSHSLRKTLRRFSAAPHCEVRIDHDFAAVIHACATTPRE 114

Query: 63  -RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +  TWI   +Q AY +   +G  H+ E W    L+GGLYGV+LG +FFGESMFSH  +A
Sbjct: 115 GQDGTWIQPELQAAYTEWHRLGAVHSFETWVDGRLLGGLYGVNLGRMFFGESMFSHATDA 174

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
           SKI L  LV   +     L+D Q  T HL   GA EI
Sbjct: 175 SKIALAALVAFCRANDIALIDCQQRTAHLGSLGAREI 211


>gi|121610549|ref|YP_998356.1| leucyl/phenylalanyl-tRNA--protein transferase [Verminephrobacter
           eiseniae EF01-2]
 gi|121555189|gb|ABM59338.1| Leucyltransferase [Verminephrobacter eiseniae EF01-2]
          Length = 292

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 94/176 (53%), Gaps = 6/176 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYI----RRELYDIRINTAFESVISACA-QK 59
              Q I W  P  R ++P+      + L+K +    R     IR++ AFE VI+ CA Q+
Sbjct: 89  GPGQPILWWTPDPRMVLPVSALRLHRSLRKTLQAFRRDAACAIRVDCAFEEVITRCASQQ 148

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
            + +  TWI   +  AYIDL   G+AH++E W    LVGGLY V+LG   FGESMF+   
Sbjct: 149 RKGQAGTWIVPEMVAAYIDLHAAGHAHSVETWVDGELVGGLYCVALGRAVFGESMFADAT 208

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL-KHP 174
           +ASKI L+ LV         ++D Q  T HL   GA EI   Q+ + +E A  +HP
Sbjct: 209 DASKIALSALVGLCLHHGIGMIDCQQNTPHLASLGAREIPRAQFLRHVEKARQQHP 264


>gi|186476420|ref|YP_001857890.1| leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia
           phymatum STM815]
 gi|226736116|sp|B2JKL7|LFTR_BURP8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|184192879|gb|ACC70844.1| Leucyltransferase [Burkholderia phymatum STM815]
          Length = 245

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 94/179 (52%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACA-QK 59
           ++ Q + W  P  R I+    F     LKK +RR L D    IR++  F +V+ ACA   
Sbjct: 52  SDGQPVLWWTPDPRMILRPREFKISPSLKKTLRRVLRDDTWEIRVDADFPAVMRACALAP 111

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              +  TWI   +  AY  L   G AH+IE W     VGGLYGVS G +FFGESM++ + 
Sbjct: 112 RHGQRGTWITSDVIDAYSTLHRRGEAHSIETWHAGKRVGGLYGVSFGKMFFGESMYAEVT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L+ LV HL++ +  ++D Q  T+HL   G  EI    +   +  A+    I +
Sbjct: 172 DASKIALSALVFHLRRHEIEMIDCQQNTSHLASLGGREIARKAFVAHVRAAVDSAPIPW 230


>gi|186684165|ref|YP_001867361.1| leucyl/phenylalanyl-tRNA--protein transferase [Nostoc punctiforme
           PCC 73102]
 gi|226737703|sp|B2J6L3|LFTR_NOSP7 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|186466617|gb|ACC82418.1| leucyl/phenylalanyl-tRNA--protein transferase [Nostoc punctiforme
           PCC 73102]
          Length = 191

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 99/174 (56%), Gaps = 7/174 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +   +SW     R  IPL E F  PK L++ + +E + + IN  F++V++ CA  
Sbjct: 19  MADERDR--LSWYGSRDRTFIPLDERFRYPKSLQRVLNQERFTVAINRDFQAVVAGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  ++K Y  L+  GYA + E W+ D L GG+ G+ +G  F GESMF  + 
Sbjct: 75  --DRETTWISPELEKIYWLLYQSGYAFSFETWQGDELAGGILGIVIGGAFIGESMFYRIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             SK+ +  LV+ L++R+F+  D Q +  HL +FGA  +    Y  LLE AL+ 
Sbjct: 133 EGSKVAMVKLVERLRQRKFVFFDAQMMNPHLERFGAYRVKDEGYQVLLEQALQR 186


>gi|268590192|ref|ZP_06124413.1| leucyltransferase [Providencia rettgeri DSM 1131]
 gi|291314473|gb|EFE54926.1| leucyltransferase [Providencia rettgeri DSM 1131]
          Length = 233

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 86/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++ +   H  + +KK ++++ Y I +N AF+ VI AC+ + +    TWI   
Sbjct: 56  WWSPDPRAVLMVGELHISRSMKKVLKKQTYRITVNHAFKQVIEACSVRQE---GTWILPE 112

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +Q  Y+ L   G AH+IEAW  D LVGGLYGV++G +F GESMFS M +ASK        
Sbjct: 113 VQAGYLALHQAGMAHSIEAWYGDKLVGGLYGVNMGHLFCGESMFSRMNDASKFAFITFYF 172

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GA EI+   +  +L
Sbjct: 173 HFLRYNGQLFDCQVLNHHTASMGAKEISRRDFLHIL 208


>gi|300691358|ref|YP_003752353.1| leucyl, phenylalanyl-tRNA-protein transferase [Ralstonia
           solanacearum PSI07]
 gi|299078418|emb|CBJ51069.1| leucyl, phenylalanyl-tRNA-protein transferase [Ralstonia
           solanacearum PSI07]
          Length = 248

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 90/179 (50%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+ AF  V+  CA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDNPAWEIRIDHAFRDVMVDCA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWYAGKRVGGLYGVALGHMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  R   ++D Q  T HL   G   +T   +   +  A   P I
Sbjct: 170 YTDASKIALAALCAFLGSRDVAMIDCQQETEHLASLGGAPVTRAVFLAHVREAANAPAI 228


>gi|163855238|ref|YP_001629536.1| leucyl/phenylalanyl-tRNA--protein transferase [Bordetella petrii
           DSM 12804]
 gi|226736110|sp|A9I8M6|LFTR_BORPD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|163258966|emb|CAP41265.1| leucyl/phenylalanyl-tRNA--protein transferase [Bordetella petrii]
          Length = 253

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 97/183 (53%), Gaps = 9/183 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETF---HTPKRLKKYIRRE------LYDIRINTAFESVISA 55
           +  + I W  P  R ++    F   H+ ++L + I RE         +R++T F++V++ 
Sbjct: 50  SEGEPILWWSPDPRMVLACADFAPSHSLRKLLRQIAREESALLPRVQVRVDTEFDAVVAQ 109

Query: 56  CAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMF 115
           CA     +  TWI   +Q+AY      G AH++E W    L GGLYG+SLG +FFGESMF
Sbjct: 110 CAAPRDGQAGTWITADMQQAYRAWHAAGVAHSVETWIDGELAGGLYGISLGRMFFGESMF 169

Query: 116 SHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           + + +ASK+ L +LV  L++     +D Q  T HL   GA  +   ++ + +  A+  P 
Sbjct: 170 TRVPDASKVALAYLVAFLRRAGVEWIDCQQQTRHLASLGARPVPRARFVEHIRQAIAGPA 229

Query: 176 ISF 178
            ++
Sbjct: 230 PAW 232


>gi|159030843|emb|CAO88522.1| aat [Microcystis aeruginosa PCC 7806]
          Length = 193

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 95/175 (54%), Gaps = 8/175 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD     D  W     R +IPL+     PK LK+ + +  + + IN  F  V + CA  
Sbjct: 21  MADEGGRLD--WYSSKNRALIPLDRRCRYPKSLKRVLNQNRFTVAINRDFAGVCAGCAD- 77

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R  TWI+  + + Y  L   G+A++ E W+ D L GG+ G+++  VF GESMF  + 
Sbjct: 78  ---RSLTWISPELIQIYQQLHQAGWAYSFETWQGDQLAGGILGLAIRGVFIGESMFYKIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA-LKH 173
           + SK+ +  LV+HL++R F L D Q    HL +FG+  I   +Y  LL++A LKH
Sbjct: 135 DGSKVAMVKLVEHLRERDFCLFDAQMQNPHLARFGSYTIPEKEYHLLLKSALLKH 189


>gi|262171261|ref|ZP_06038939.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           MB-451]
 gi|261892337|gb|EEY38323.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           MB-451]
          Length = 243

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y I +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFEPARFQPSKSVKKFQRKHQYRISLNQATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 TQMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + +  L+D Q +  HL   GA  ++  Q+ + L
Sbjct: 177 CDHFSRHKGQLIDCQVMNPHLESLGATTLSREQFIQSL 214


>gi|258621477|ref|ZP_05716511.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           VM573]
 gi|258586865|gb|EEW11580.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           VM573]
          Length = 243

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y I +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFQPARFQPSKSVKKFQRKHQYRISLNQATSQVIEQCA-LTRPSDQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 TQMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + +  L+D Q +  HL   GA  ++  Q+ + L
Sbjct: 177 CDHFARHKGQLIDCQVMNPHLESLGATTLSREQFIQSL 214


>gi|283833823|ref|ZP_06353564.1| leucyltransferase [Citrobacter youngae ATCC 29220]
 gi|291070491|gb|EFE08600.1| leucyltransferase [Citrobacter youngae ATCC 29220]
          Length = 234

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R I+  + FH  + +K++ +   Y + +N AF  VI  CA   ++   TWI 
Sbjct: 56  ILWWSPDPRAILWPDKFHLSRSMKRFHKNSPYRVTLNYAFGQVIEGCANDREE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L  +G+AH+IE W+++ LVGG+YGV+ G +F GESMFS  ENASK  L   
Sbjct: 114 HDVVDAYHRLHELGHAHSIEVWRQNELVGGMYGVAQGTLFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                ++   L+D Q + +H    GAIE    +Y + L
Sbjct: 174 CAEFIRQGGKLIDCQVLNSHTASLGAIETPRREYLEHL 211


>gi|237730849|ref|ZP_04561330.1| leucyl/phenylalanyl-tRNA-protein transferase [Citrobacter sp. 30_2]
 gi|226906388|gb|EEH92306.1| leucyl/phenylalanyl-tRNA-protein transferase [Citrobacter sp. 30_2]
          Length = 234

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R I+  E FH  + +K++ +   Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAILWPEKFHLSRSMKRFHKNSPYRVTLNYAFGQVIEGCANDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +G+AH+IE W+ + LVGG+YGV+ G +F GESMFS  ENASK 
Sbjct: 109 GTWITHDVVDAYHRLHELGHAHSIEVWRHNELVGGMYGVAQGTLFCGESMFSRQENASKT 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            L        ++   L+D Q + +H    GA+E    +Y + L
Sbjct: 169 ALLVFCAEFIRQGGKLIDCQVLNSHTASLGAVETPRREYLEHL 211


>gi|229515126|ref|ZP_04404586.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae TMA
           21]
 gi|229347831|gb|EEO12790.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae TMA
           21]
          Length = 243

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + +  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHKGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|262165896|ref|ZP_06033633.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           VM223]
 gi|262025612|gb|EEY44280.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           VM223]
          Length = 243

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y I +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFEPARFQPSKSVKKFQRKHQYRISLNQATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 TQMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + +  L+D Q +  HL   GA  ++  Q+ + L
Sbjct: 177 CDHFARHKGQLIDCQVMNPHLESLGATTLSREQFIQSL 214


>gi|238897273|ref|YP_002922950.1| leucyl/phenylalanyl-tRNA-protein transferase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|259494488|sp|C4K842|LFTR_HAMD5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|229465028|gb|ACQ66802.1| leucyl/phenylalanyl-tRNA-protein transferase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 230

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 91/166 (54%), Gaps = 6/166 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIR--RELYDIRINTAFESVISACAQKTQKRP 64
            + I W  P  R +  L   H  + +K++IR  R  Y   +N AF  VI+ CA  T++  
Sbjct: 53  GEPILWWSPDPRAV--LLKCHVSRSMKRFIRPGRCPYHFSLNCAFSDVITTCA--TKRSG 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  I KAY  L  +G AH++E W KD LVGGLYG+S+GA+F GESMFS  +NASK 
Sbjct: 109 CTWISSDIVKAYCQLHRLGRAHSVEVWLKDKLVGGLYGISVGAMFCGESMFSIADNASKS 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
            L     +  ++    +D Q +  H    GA +I    +  LL+ A
Sbjct: 169 ALIIFEHYFTQKGGKWIDCQVLNAHTACLGAEQIPRNDFLSLLDQA 214


>gi|218246726|ref|YP_002372097.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp. PCC
           8801]
 gi|257059765|ref|YP_003137653.1| leucyl/phenylalanyl-tRNA--protein transferase [Cyanothece sp. PCC
           8802]
 gi|218167204|gb|ACK65941.1| leucyl/phenylalanyl-tRNA/protein transferase [Cyanothece sp. PCC
           8801]
 gi|256589931|gb|ACV00818.1| leucyl/phenylalanyl-tRNA/protein transferase [Cyanothece sp. PCC
           8802]
          Length = 193

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 96/172 (55%), Gaps = 7/172 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD      + W    +R +IPL E F  PK L++ + +  + + IN  F  V   CAQ 
Sbjct: 21  MADDMGI--MGWYSSRKRALIPLDERFRYPKSLQRVLNQNRFSVAINRDFLGVCEGCAQ- 77

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  +   Y DL+  G+AH+ E W+ D L GG+ G+++G  F GESMF  + 
Sbjct: 78  ---RETTWISPQLIDIYYDLYQEGWAHSFETWQGDELAGGILGIAIGGAFIGESMFYRIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
             SK+ +  LV+HLKKR F+L D Q    HL +FGA ++    Y  LL+ AL
Sbjct: 135 EGSKVAMVKLVEHLKKRNFILFDAQLQNPHLERFGAYQVNDQTYQVLLQKAL 186


>gi|153212104|ref|ZP_01947921.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           1587]
 gi|124116900|gb|EAY35720.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio cholerae
           1587]
          Length = 243

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + +  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSRHKGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|91793193|ref|YP_562844.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella
           denitrificans OS217]
 gi|123060949|sp|Q12N55|LFTR_SHEDO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|91715195|gb|ABE55121.1| Leucyltransferase [Shewanella denitrificans OS217]
          Length = 233

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 85/150 (56%), Gaps = 2/150 (1%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
             + I W  P  R +  L  +   + L K ++R+ +   IN AF++VI  CA   Q+   
Sbjct: 52  QGEPILWWTPDPRAVFQLSDYRPSRSLMKTLKRQTWRFTINKAFDAVIHQCAALRQE--G 109

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   I+ AY  L   G AH+IE W+ + LVGGLYG+++G +F GESMF    +ASK  
Sbjct: 110 TWITPAIKAAYGQLHAQGDAHSIEVWQGEQLVGGLYGIAVGKIFCGESMFHLETDASKAA 169

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
              LV HL++ +F L+D Q +  HL + GA
Sbjct: 170 FHLLVTHLRRFEFTLIDAQVMNPHLARLGA 199


>gi|264677803|ref|YP_003277709.1| leucyl/phenylalanyl-tRNA--protein transferase [Comamonas
           testosteroni CNB-2]
 gi|262208315|gb|ACY32413.1| leucyl/phenylalanyl-tRNA--protein transferase [Comamonas
           testosteroni CNB-2]
          Length = 249

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHT----PKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           +  Q + W  P  R  +  E F       KRL+K+      +IRI++AF +V+  CAQ  
Sbjct: 55  SEGQPVLWWSPNPRMALHPEEFRLHRSLRKRLQKFRNDPRCEIRIDSAFATVMQHCAQTP 114

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI  +I  AY +L   G AH++E W    LVGGLY V+LG   FGESMF+   
Sbjct: 115 RDGQNGTWIVQSIVDAYTELHQQGAAHSVETWIDGQLVGGLYCVALGRAVFGESMFALQT 174

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L+ LV   +  Q   +D Q  T HL   GA E+T  Q+A+ ++   + P++ +
Sbjct: 175 DASKIALSALVALCRAHQVPQIDCQQATAHLSFMGAREVTRAQFARTVQAQARLPDMQW 233


>gi|239907007|ref|YP_002953748.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           magneticus RS-1]
 gi|259494485|sp|C4XT58|LFTR_DESMR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|239796873|dbj|BAH75862.1| leucyl/phenylalanyl-tRNA--protein transferase [Desulfovibrio
           magneticus RS-1]
          Length = 247

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 89/166 (53%), Gaps = 1/166 (0%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           +   I W  P  R I+        KRL++ IR   + + ++T F  VI  CA   +    
Sbjct: 49  DESPILWWSPDPRPILVPGHVRVSKRLERTIRSGKFTVTLDTDFAGVIRGCAAVPRDADN 108

Query: 66  -TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + + Y  L   G+AH++EAW+   LVGG YGV++G  FFGESMF    +ASK+
Sbjct: 109 GTWIVPDMIEGYERLHAAGHAHSVEAWQNGELVGGAYGVAIGKAFFGESMFHRATDASKV 168

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
               L + L + +F  +D Q  T HL +FGA+++   ++ + LE A
Sbjct: 169 AFVTLCRFLDRHEFRFIDCQQATGHLLRFGAVQVRRNEFLRRLEAA 214


>gi|67924600|ref|ZP_00518014.1| Leucyl/phenylalanyl-tRNA--protein transferase [Crocosphaera
           watsonii WH 8501]
 gi|67853551|gb|EAM48896.1| Leucyl/phenylalanyl-tRNA--protein transferase [Crocosphaera
           watsonii WH 8501]
          Length = 193

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 97/177 (54%), Gaps = 7/177 (3%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           M D  N   + W    +R +IPL E F  PK LK+ + + ++ + I+  F  V   CA  
Sbjct: 21  MGDENNV--LGWYSSRQRALIPLDERFRYPKSLKRVLNQNIFSVAIDRDFMGVCRGCA-- 76

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI   +   Y  L   GYAH+ E W+ D L GG+ G++LG  F GESMF  + 
Sbjct: 77  --DRQTTWIAPELIDIYYQLHLAGYAHSFETWQGDELAGGILGITLGGAFLGESMFFRIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           N SK+ +  LV+HL+ + F L D Q    HL +FG+  ++  +Y KLL+ +L +P I
Sbjct: 135 NGSKVAMVKLVEHLRGKGFTLFDAQLQNEHLARFGSYLVSDQEYQKLLQESLNNPCI 191


>gi|312890758|ref|ZP_07750290.1| leucyl/phenylalanyl-tRNA/protein transferase [Mucilaginibacter
           paludis DSM 18603]
 gi|311296772|gb|EFQ73909.1| leucyl/phenylalanyl-tRNA/protein transferase [Mucilaginibacter
           paludis DSM 18603]
          Length = 209

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 91/165 (55%), Gaps = 4/165 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KR 63
           ++   I W  P  R ++        K +++ IR   + ++ +TAF  VI  CA   +  +
Sbjct: 47  SDETPILWYSPHERFVLFPNELKVSKSMRQVIRSGKFKVKFDTAFADVIVNCANAERIDQ 106

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q+AYI L  +G+AH++E W  D L GGLYGV +G VF GESMFS + NASK
Sbjct: 107 DGTWITNDMQQAYIKLHQLGHAHSVEVWLGDELAGGLYGVEVGNVFCGESMFSKVSNASK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           + L  L +  K   + ++D Q  TNHL   GA  I+   Y + L+
Sbjct: 167 LALITLCQTGK---YQMIDCQVYTNHLASLGAGMISREMYLEWLQ 208


>gi|311280205|ref|YP_003942436.1| leucyl/phenylalanyl-tRNA/protein transferase [Enterobacter cloacae
           SCF1]
 gi|308749400|gb|ADO49152.1| leucyl/phenylalanyl-tRNA/protein transferase [Enterobacter cloacae
           SCF1]
          Length = 234

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 85/159 (53%), Gaps = 2/159 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  + FH  + +K++ +   Y + +N AF  VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPDAFHVSRSMKRFHKTSPYRVTLNHAFGKVIEGCAGDRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +I  AY  L  +G+AH+IE W+ D LVGG+YGV+ G +F GESMFS   NASK  L   
Sbjct: 114 DSIVLAYHRLHELGHAHSIEVWRDDELVGGMYGVAQGTLFCGESMFSRAVNASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
                ++   L+D Q + +H    GA+E+    Y   L+
Sbjct: 174 CNEFTRQGGKLIDCQVLNDHTASLGAVEMPRRHYLDALD 212


>gi|329961968|ref|ZP_08299979.1| leucyltransferase [Bacteroides fluxus YIT 12057]
 gi|328530616|gb|EGF57474.1| leucyltransferase [Bacteroides fluxus YIT 12057]
          Length = 212

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 83/160 (51%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P+ R +I  +  H    ++  I +  Y +  N AF  VI  C          W+ 
Sbjct: 53  IQWWCPMDRFVIFPDEIHISHSMRTLINKGKYRLTFNQAFREVIQTCGNLRIDMEGAWLG 112

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L   G+A ++E W K+ L+GGLYGV+LG  FFGESMFS + +ASK+ L HL
Sbjct: 113 KDMMDAYTRLHEQGFAASVEVWDKERLIGGLYGVTLGRCFFGESMFSLVSDASKLALIHL 172

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
               +    +++D QF T HL   G   I++ +Y K +E 
Sbjct: 173 AATFRSLGGVMIDCQFETPHLLSMGGRHISYEEYMKYIEQ 212


>gi|319956044|ref|YP_004167307.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitratifractor
           salsuginis DSM 16511]
 gi|319418448|gb|ADV45558.1| leucyl/phenylalanyl-tRNA/protein transferase [Nitratifractor
           salsuginis DSM 16511]
          Length = 244

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 94/164 (57%), Gaps = 1/164 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP-TTWI 68
           I W  P  R ++    F   +  ++ +R   Y +  +  FE+VI ACA   +++   TW+
Sbjct: 62  ILWWSPDPRLLLYPRDFRVSRSFRRVLRNREYRVAFDHDFEAVIQACATMPERQEKGTWL 121

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +Q+AY +L + G+AH++E ++   L+GGLYG+++G  FFGESMFS   + SKI L  
Sbjct: 122 MPEMQEAYTELHHRGFAHSVEVYEAGELIGGLYGIAIGRAFFGESMFSRKRDGSKIALKA 181

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           L   L ++ +  +D Q +++HL + GA  +   ++   LE AL+
Sbjct: 182 LSDVLSEKGYDFIDCQVVSDHLVRLGAKPVPRARFLGELETALQ 225


>gi|313683052|ref|YP_004060790.1| leucyl/phenylalanyl-tRNA/protein transferase [Sulfuricurvum
           kujiense DSM 16994]
 gi|313155912|gb|ADR34590.1| leucyl/phenylalanyl-tRNA/protein transferase [Sulfuricurvum
           kujiense DSM 16994]
          Length = 220

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 97/165 (58%), Gaps = 4/165 (2%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISAC-AQKTQK 62
           SAN   I W  P  R I+ L+ F   + L+K I +  ++IR NTAF  VI  C A     
Sbjct: 47  SAN-DPILWWSPDPRLILELDEFKLSRSLRKKIPQ--FEIRFNTAFAEVIRECSAAPRPG 103

Query: 63  RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
           +  +WI   + +AY  L  +G+AH+IEA++  +LVGGLYGVS+G VF GESMF+ + +AS
Sbjct: 104 QKGSWIVPEMIEAYETLHALGHAHSIEAYQNGILVGGLYGVSVGKVFCGESMFAKVSDAS 163

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           K  L   ++ L++  +  +D Q  T HL+  GA EI+   + + L
Sbjct: 164 KAALAVWIEQLREWGYDFIDCQVPTAHLKSLGAKEISRAAFLERL 208


>gi|299531623|ref|ZP_07045028.1| leucyl/phenylalanyl-tRNA--protein transferase [Comamonas
           testosteroni S44]
 gi|298720339|gb|EFI61291.1| leucyl/phenylalanyl-tRNA--protein transferase [Comamonas
           testosteroni S44]
          Length = 249

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHT----PKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           +  Q + W  P  R  +  E F       KRL+K+      +IRI++AF +V+  CAQ  
Sbjct: 55  SEGQPVLWWSPNPRMALHPEEFRLHRSLRKRLQKFRNDPRCEIRIDSAFATVMQHCAQTP 114

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI  +I  AY +L   G AH++E W    LVGGLY V+LG   FGESMF+   
Sbjct: 115 RDGQNGTWIVQSIVDAYTELHQQGAAHSVETWIDGQLVGGLYCVALGRAVFGESMFALQT 174

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L+ LV   +  Q   +D Q  T HL   GA E+T  Q+A+ ++   + P++ +
Sbjct: 175 DASKIALSALVALCRAHQVPQIDCQQATAHLSFMGAREVTRAQFARTVQAQAQLPDMQW 233


>gi|207724154|ref|YP_002254552.1| hypothetical protein RSMK01581 [Ralstonia solanacearum MolK2]
 gi|206589363|emb|CAQ36325.1| l/ leucyl/phenylalanyl-trna--protein transferase (l/f-transferase)
           (leucyltransferase) (phenyalanyltransferase) [Ralstonia
           solanacearum MolK2]
          Length = 248

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 90/179 (50%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+ AF  V+  CA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDNPAWEIRIDHAFRDVMVDCA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWYAGRRVGGLYGVALGHMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  R   ++D Q  T HL   G   +   ++   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGSRGVTMIDCQQETEHLASLGGAPVPRAEFLAHVRAAANAPAI 228


>gi|227112009|ref|ZP_03825665.1| leucyl/phenylalanyl-tRNA--protein transferase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 234

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 85/161 (52%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++     H  + +KK+++R  +   +N AF+ VI ACA +      T
Sbjct: 53  GEPILWWSPNPRAVLFPGDLHISRSMKKFLKRHTFHATLNQAFDDVIHACAHEHHD--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI  +I  AY  L   G AH++E W+ DVLVGGLYG+  G +F GESMFS  +NASK  L
Sbjct: 111 WITPSIISAYRQLHQAGKAHSVEVWQNDVLVGGLYGIEQGRLFCGESMFSRTDNASKYAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +H  +    L+D Q +  H    G  EI   ++ + L
Sbjct: 171 LAFQQHFIRHGGELIDCQVLNAHTASLGVSEIPRDRFLQQL 211


>gi|300703928|ref|YP_003745530.1| leucyl, phenylalanyl-tRNA-protein transferase [Ralstonia
           solanacearum CFBP2957]
 gi|299071591|emb|CBJ42915.1| leucyl, phenylalanyl-tRNA-protein transferase [Ralstonia
           solanacearum CFBP2957]
          Length = 248

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 90/179 (50%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+ AF  V+  CA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDNPAWEIRIDHAFRDVMVDCA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWYAGRRVGGLYGVALGHMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  R   ++D Q  T HL   G   +   ++   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGSRGVAMIDCQQETEHLASLGGAPVPRAEFLAHVRAAANAPAI 228


>gi|56459780|ref|YP_155061.1| leucyl/phenylalanyl-tRNA--protein transferase [Idiomarina
           loihiensis L2TR]
 gi|61213271|sp|Q5R0B5|LFTR_IDILO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|56178790|gb|AAV81512.1| Leu/Phe-tRNA-protein transferase [Idiomarina loihiensis L2TR]
          Length = 236

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 82/154 (53%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           + S  I W  P  R +   +  HT + L K  R+  + + IN  F  V+ ACA +   + 
Sbjct: 50  SESDPILWWSPNPRAVFFPDQIHTSRSLAKTNRKPNWQMSINCNFAEVVRACADERADKE 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +GYAH++E W  + L GGLYG+S+G  F GESMF +  +ASKI
Sbjct: 110 GTWITEEMIEAYCKLHQLGYAHSVEIWFDNELAGGLYGISVGRAFCGESMFHYKTDASKI 169

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
            L    ++ KK    L+D Q    HL   GA+ +
Sbjct: 170 ALLRFAQYFKKHGGQLIDCQVGNPHLFSLGAVNL 203


>gi|313200908|ref|YP_004039566.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylovorus sp.
           MP688]
 gi|312440224|gb|ADQ84330.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylovorus sp.
           MP688]
          Length = 231

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 87/160 (54%), Gaps = 1/160 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  + + W  P  R ++  E     + L+K +R+  Y++R NT F  V+  CA+  +  +
Sbjct: 60  SEGEPVLWWSPNPRMVLFPEELKVSRSLEKRLRKPNYEVRYNTCFLQVMRRCAEIPRAHQ 119

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   I   Y  L  MG+A + E W    LVGGLYGV LG +F+GESMF    +ASK
Sbjct: 120 DGTWITEEIVAGYHALHQMGHAMSAETWMAGELVGGLYGVRLGGMFYGESMFHARTDASK 179

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           I   HLV+ L+++   ++D Q  T HL   GA EI   ++
Sbjct: 180 IAFVHLVRDLQRQGVRMIDCQMKTAHLASLGAREIPRAEF 219


>gi|308049695|ref|YP_003913261.1| leucyl/phenylalanyl-tRNA/protein transferase [Ferrimonas balearica
           DSM 9799]
 gi|307631885|gb|ADN76187.1| leucyl/phenylalanyl-tRNA/protein transferase [Ferrimonas balearica
           DSM 9799]
          Length = 237

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 83/146 (56%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +  + T    + L+K +R++ +   I+ AF+ VI+ACA     +  TWI+
Sbjct: 58  ILWWSPNPRAVFDIYTLSPSRSLRKAVRQQGWQYSIDLAFDRVIAACAAPRNNQDGTWIS 117

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +Q AY  L + G+AH++E W  + L+GGLYG+++G++F GESMF    NASK     L
Sbjct: 118 EEMQHAYRRLHHEGHAHSVEVWDGNELIGGLYGLAIGSLFCGESMFHTRSNASKAAFWAL 177

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGA 155
             HL K     +D Q   +HL + GA
Sbjct: 178 SSHLHKAGGRWIDAQVPNDHLMRLGA 203


>gi|17546336|ref|NP_519738.1| leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia
           solanacearum GMI1000]
 gi|33301309|sp|Q8XYY9|LFTR_RALSO RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|17428633|emb|CAD15319.1| probable l/ leucyl/phenylalanyl-trna--protein transferase
           (l/f-transferase) (leucyltransferase)
           (phenyalanyltransferase) [Ralstonia solanacearum
           GMI1000]
          Length = 248

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+ AF  V+  CA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPTWEIRIDHAFRDVMVDCA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWHGGRRVGGLYGVALGHMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  R   ++D Q  T HL   G   +    +   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGSRGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASAPAI 228


>gi|253998821|ref|YP_003050884.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylovorus sp.
           SIP3-4]
 gi|253985500|gb|ACT50357.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylovorus sp.
           SIP3-4]
          Length = 231

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 87/160 (54%), Gaps = 1/160 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  + + W  P  R ++  E     + L+K +R+  Y++R NT F  V+  CA+  +  +
Sbjct: 60  SEGEPVLWWSPNPRMVLFPEELKVSRSLEKRLRKPDYEVRYNTCFLQVMRRCAEIPRAHQ 119

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   I   Y  L  MG+A + E W    LVGGLYGV LG +F+GESMF    +ASK
Sbjct: 120 DGTWITEEIVAGYHALHQMGHAMSAETWMAGELVGGLYGVRLGGMFYGESMFHARTDASK 179

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           I   HLV+ L+++   ++D Q  T HL   GA EI   ++
Sbjct: 180 IAFVHLVRDLQRQGVRMIDCQMKTAHLASLGAREIPRAEF 219


>gi|188991662|ref|YP_001903672.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           campestris pv. campestris str. B100]
 gi|226737728|sp|B0RT37|LFTR_XANCB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|167733422|emb|CAP51623.1| leucyltransferase [Xanthomonas campestris pv. campestris]
          Length = 249

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 94/174 (54%), Gaps = 5/174 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ Q + W  P  R +   +  H   R ++ +R   + +R +TAF  VI+ACA  +  RP
Sbjct: 55  SDGQPLLWWSPNPRTVFRTDAIHLSSRFRRQLRTCTWTLRADTAFAQVIAACA--SSPRP 112

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AY+DL   GYAH++E +    LVGG+YGV++G +FFGESMFS     
Sbjct: 113 GQDGTWITDQMQEAYLDLHRRGYAHSVEVFDGARLVGGIYGVAIGQMFFGESMFSGASGG 172

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           SKI L  L   L    + L+D Q    HL + GA  +   Q+ + +   +  PE
Sbjct: 173 SKIALAALAAKLHGLGWPLIDAQVENAHLMRLGAQRLPREQFLQHVATQVALPE 226


>gi|258627476|ref|ZP_05722257.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           VM603]
 gi|258580282|gb|EEW05250.1| Leucyl/phenylalanyl-tRNA--protein transferase [Vibrio mimicus
           VM603]
          Length = 243

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 84/158 (53%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y I +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFEPARFQPSKSVKKFQRKHQYRISLNQATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY +L   G  H++E W+   LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 TQMRHAYGELAKQGRCHSVEVWQGKQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + +  L+D Q +  HL   GA  ++  Q+ + L
Sbjct: 177 CDHFARHKGQLIDCQVMNPHLESLGATTLSREQFIQSL 214


>gi|241663198|ref|YP_002981558.1| leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia pickettii
           12D]
 gi|240865225|gb|ACS62886.1| leucyl/phenylalanyl-tRNA/protein transferase [Ralstonia pickettii
           12D]
          Length = 248

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+  F   + ACA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPAWEIRIDHGFRETMVACA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++EAW     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTSLHRRGYAHSVEAWYAGQRVGGLYGVALGRMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  +   ++D Q  T HL   G   +    +   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGGQGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAANAPAI 228


>gi|213618685|ref|ZP_03372511.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
          Length = 199

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 80/146 (54%), Gaps = 2/146 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVF 173

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGA 155
                +    L+D Q + +H    GA
Sbjct: 174 CAEFTRHGGKLIDCQVLNSHTASLGA 199


>gi|309782600|ref|ZP_07677323.1| leucyltransferase [Ralstonia sp. 5_7_47FAA]
 gi|308918691|gb|EFP64365.1| leucyltransferase [Ralstonia sp. 5_7_47FAA]
          Length = 248

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+  F   + ACA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPAWEIRIDHGFRETMVACA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++EAW     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTSLHRRGYAHSVEAWYAGERVGGLYGVALGRMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  +   ++D Q  T HL   G   +    +   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGGQGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAANAPAI 228


>gi|149280527|ref|ZP_01886644.1| leucyl/phenylalanyl-tRNA--protein transferase [Pedobacter sp.
           BAL39]
 gi|149228709|gb|EDM34111.1| leucyl/phenylalanyl-tRNA--protein transferase [Pedobacter sp.
           BAL39]
          Length = 212

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 85/164 (51%), Gaps = 4/164 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +    I W  P  R +I  E     K + K +R +++ +  N  F  VI  CA   +K +
Sbjct: 48  SEDDPICWYSPHERCVIFPEAVKVSKSMAKVLRDDVFSVTFNQDFPEVIRNCAAIGRKDQ 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           P TWI   +Q+AYI L   GY  ++E WK   L GGLYG+ +G+VF GESMFS + NASK
Sbjct: 108 PGTWITQEMQEAYIRLHQEGYGKSVEVWKDGELAGGLYGLQIGSVFCGESMFSKVSNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
              T L+   K+  F L+D Q    HL   GA  I+   Y   L
Sbjct: 168 ---TALIWLCKQGGFELIDCQMPNEHLLSLGAEMISREVYDGYL 208


>gi|262404147|ref|ZP_06080702.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. RC586]
 gi|262349179|gb|EEY98317.1| leucyl/phenylalanyl-tRNA--protein transferase [Vibrio sp. RC586]
          Length = 243

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 1/158 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     +   K +KK+ R+  Y I +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFQPARYQPSKSVKKFQRKHQYRISLNQATSHVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             ++ AY +L   G  H++E W  + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DPMRHAYGELAKQGRCHSVEVWHDEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             H  + Q  L+D Q +  HL+  GA  ++  Q+ + L
Sbjct: 177 CDHFSQHQGQLIDCQVMNPHLQSLGATTLSREQFIQSL 214


>gi|307718942|ref|YP_003874474.1| leucyl/phenylalanyl-tRNA--protein transferase [Spirochaeta
           thermophila DSM 6192]
 gi|306532667|gb|ADN02201.1| leucyl/phenylalanyl-tRNA--protein transferase [Spirochaeta
           thermophila DSM 6192]
          Length = 279

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 94/166 (56%), Gaps = 1/166 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R I+     H  KRL++ +RR  +    + AFE VI ACA   ++ +  TWI
Sbjct: 64  ILWWSPEIRCILWSNDLHISKRLRRDLRRTDFRFSADLAFEQVIHACATIPRRGQEGTWI 123

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              ++ AYI L ++GYAH++E W+ + LVGG YGVSLG VFFGESMFS ++NASK  L  
Sbjct: 124 TPEMRDAYIRLHHLGYAHSVEVWRGEALVGGFYGVSLGRVFFGESMFSLVDNASKAALVF 183

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                 +    L+D Q  T+HL + GA+ +    +   L   L+ P
Sbjct: 184 SRALFLRLGITLVDCQVPTDHLLRMGAVTVPREDFLASLGPLLRTP 229


>gi|168705671|ref|ZP_02737948.1| leucyl/phenylalanyl-tRNA--protein transferase [Gemmata
           obscuriglobus UQM 2246]
          Length = 239

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (50%), Gaps = 24/194 (12%)

Query: 6   NSQD-ISWIKPLRRGIIPLET-----------FHTPKRLKKYIRRELYDIRINTAFESVI 53
           N  D I W  P  RG+I L              H  +RL + IR   + + +N  F +V+
Sbjct: 48  NEGDPILWWSPDPRGVIELHGESADGAPGYGGLHVSRRLARTIRSGKFRVTVNQCFATVM 107

Query: 54  SACAQKTQKRP-TTWINMTIQKAYIDLFYMGYAHTIEAW------KKDV--LVGGLYGVS 104
             C ++   RP  TW+   +   Y +L  +G+AH++E W        D   L GG YGVS
Sbjct: 108 RECGER---RPEGTWVTPEMLAGYAELHRLGHAHSLETWVWAGGAGPDAWELAGGTYGVS 164

Query: 105 LGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYA 164
           +G +F  ESMF  + + SK+ L  LV+ L++R ++LLD+Q  T+H    GA E+   +Y 
Sbjct: 165 IGGLFAAESMFYRVTDGSKVALAALVQRLRERGYVLLDVQMKTDHTTTMGATEVPRREYL 224

Query: 165 KLLENALKHPEISF 178
           K L  A+    ISF
Sbjct: 225 KRLRRAVAMTGISF 238


>gi|190574288|ref|YP_001972133.1| leucyl/phenylalanyl-tRNA--protein transferase [Stenotrophomonas
           maltophilia K279a]
 gi|190012210|emb|CAQ45833.1| putative leucyl/phenylalanyl-tRNA--protein transferase
           [Stenotrophomonas maltophilia K279a]
          Length = 246

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 91/169 (53%), Gaps = 1/169 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           +  + I W  P  R +   E  H   R ++ +R   +++  +TAF  V+ ACA   +  +
Sbjct: 55  SEGEPILWWSPDPRMVFRTEGVHLSSRFRRQLRSSTWEVTADTAFSRVMRACAAAPRPGQ 114

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  + +AY  L  +G+AH+ E W +  LVGG+YGV++G++FFGESMFS     SK
Sbjct: 115 DGTWISPAMVEAYGQLHDLGFAHSFEVWDRQTLVGGIYGVAIGSMFFGESMFSGASGGSK 174

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           I L  L   L    + L+D Q    HL + GA  +   ++ + +  A++
Sbjct: 175 IALAALASILHGWGWELIDAQVENPHLLRMGAEHLPRAEFLQHVRRAVR 223


>gi|90579116|ref|ZP_01234926.1| hypothetical leucyl/phenylalanyl-tRNA-proteintransferase [Vibrio
           angustum S14]
 gi|90439949|gb|EAS65130.1| hypothetical leucyl/phenylalanyl-tRNA-proteintransferase [Vibrio
           angustum S14]
          Length = 237

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 80/159 (50%), Gaps = 1/159 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + + W  P  RG+    TF   K LKK+ R+  Y I IN A   VI  CA   +   
Sbjct: 53  SEGEPLLWWSPTPRGVFHPRTFMPSKSLKKFFRKSGYTITINKACHDVIRHCA-SCRGPE 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +G  H++E W  + LVGG YGV +G VF GESMFS  +NASKI
Sbjct: 112 QTWITEEMISAYQRLHTLGICHSVEVWSNEKLVGGFYGVEIGTVFCGESMFSLADNASKI 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            L    ++  +    L+D Q +  HL   GA      Q+
Sbjct: 172 ALWQFCRYFSELGGTLIDCQMMNPHLESLGAETFERSQF 210


>gi|83745872|ref|ZP_00942929.1| Leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia
           solanacearum UW551]
 gi|207743004|ref|YP_002259396.1| l/ leucyl/phenylalanyl-trna--protein transferase (l/f-transferase)
           (leucyltransferase) (phenyalanyltransferase) [Ralstonia
           solanacearum IPO1609]
 gi|83727562|gb|EAP74683.1| Leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia
           solanacearum UW551]
 gi|206594401|emb|CAQ61328.1| l/ leucyl/phenylalanyl-trna--protein transferase (l/f-transferase)
           (leucyltransferase) (phenyalanyltransferase) [Ralstonia
           solanacearum IPO1609]
          Length = 248

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+ AF  V+  CA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDNPAWEIRIDHAFRDVMVDCA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWYAGRRVGGLYGVALGHMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  R   ++D Q  T HL   G   +    +   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGSRGVAMIDCQQETEHLASLGGAPVPRAAFLAHVRAAANAPAI 228


>gi|221067888|ref|ZP_03543993.1| leucyl/phenylalanyl-tRNA/protein transferase [Comamonas
           testosteroni KF-1]
 gi|220712911|gb|EED68279.1| leucyl/phenylalanyl-tRNA/protein transferase [Comamonas
           testosteroni KF-1]
          Length = 249

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHT----PKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           +  Q + W  P  R  +  E F       KRL+K+      +IRI++AF +V+  CAQ  
Sbjct: 55  SEGQPVLWWSPNPRMALHPEEFRLHRSLRKRLQKFRDDPGCEIRIDSAFATVMQHCAQTP 114

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI  +I  AY +L   G AH++E W    LVGGLY V+LG   FGESMF+   
Sbjct: 115 RDGQNGTWIVQSIIDAYTELHQQGAAHSVETWIDGQLVGGLYCVALGRAVFGESMFALQT 174

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L+ LV   +  Q   +D Q  T HL   GA EIT  Q+A+ ++   + P++ +
Sbjct: 175 DASKIALSALVALCRAHQVPQIDCQQATAHLSFMGAREITRAQFARTVQAQSQLPDMQW 233


>gi|33301292|sp|Q8DKJ8|LFTR_THEEB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 196

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 95/166 (57%), Gaps = 5/166 (3%)

Query: 10  ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           + W    +R +IPL E F  P  L++ + +  + + IN  F +V+  CA     RP TWI
Sbjct: 31  LEWYTSRQRALIPLDERFRYPASLRRVLNQNRFQVAINRDFSAVVEGCA----DRPMTWI 86

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +++ Y  L+  G+A + E W+ D L GG+ G+ +G  F GESMF  + N SK+ +  
Sbjct: 87  TPRLKEVYHLLYATGWAVSFETWQGDELAGGILGIVIGGAFIGESMFYRIPNGSKVAMVK 146

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           LV+HL++R FLL D Q    HL +FGA  ++  +Y +LL  A++ P
Sbjct: 147 LVEHLRQRGFLLFDAQLQNPHLERFGAYVVSPRKYRQLLAQAIRKP 192


>gi|212709758|ref|ZP_03317886.1| hypothetical protein PROVALCAL_00806 [Providencia alcalifaciens DSM
           30120]
 gi|212687569|gb|EEB47097.1| hypothetical protein PROVALCAL_00806 [Providencia alcalifaciens DSM
           30120]
          Length = 240

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 86/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++ +   H  + + K +++  Y I IN AF++VI ACA + +    TWI  +
Sbjct: 56  WWSPDPRAVLMVGDLHISRSMIKTLKKSPYRITINHAFKNVIEACAVRQEG---TWILPS 112

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +Q  Y+ L   G AH+IEAW  + LVGGLYGV++G +F GESMFS M +ASK        
Sbjct: 113 VQAGYLALHQEGLAHSIEAWHGEKLVGGLYGVNMGHLFCGESMFSKMNDASKCAFITFYF 172

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GA EI+   +  +L
Sbjct: 173 HFLRYNGQLFDCQVLNHHTASLGATEISRRDFLHIL 208


>gi|22298404|ref|NP_681651.1| leucyl/phenylalanyl-tRNA--protein transferase [Thermosynechococcus
           elongatus BP-1]
 gi|22294583|dbj|BAC08413.1| leucyl/phenylalanyl-tRNA--protein transferase [Thermosynechococcus
           elongatus BP-1]
          Length = 204

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 95/166 (57%), Gaps = 5/166 (3%)

Query: 10  ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           + W    +R +IPL E F  P  L++ + +  + + IN  F +V+  CA     RP TWI
Sbjct: 39  LEWYTSRQRALIPLDERFRYPASLRRVLNQNRFQVAINRDFSAVVEGCA----DRPMTWI 94

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +++ Y  L+  G+A + E W+ D L GG+ G+ +G  F GESMF  + N SK+ +  
Sbjct: 95  TPRLKEVYHLLYATGWAVSFETWQGDELAGGILGIVIGGAFIGESMFYRIPNGSKVAMVK 154

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           LV+HL++R FLL D Q    HL +FGA  ++  +Y +LL  A++ P
Sbjct: 155 LVEHLRQRGFLLFDAQLQNPHLERFGAYVVSPRKYRQLLAQAIRKP 200


>gi|152980526|ref|YP_001354201.1| leucyl/phenylalanyl-tRNA--protein transferase [Janthinobacterium
           sp. Marseille]
 gi|166224663|sp|A6T104|LFTR_JANMA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|151280603|gb|ABR89013.1| leucyl/phenylalanyl-tRNA--protein transferase [Janthinobacterium
           sp. Marseille]
          Length = 244

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 80/141 (56%)

Query: 37  RRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVL 96
           R   ++IR + AFE V+ ACA        TWI+  I   Y  L  +GYAH+ E W +  L
Sbjct: 93  RDGQWEIRFDHAFEEVMRACAAPRNGEGGTWISDEIIAGYTGLHKLGYAHSSELWLQGKL 152

Query: 97  VGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAI 156
           VG  YGVS+G +F+GESMF+ + +ASKI L +LV  L+     ++D Q  T+HL   GA 
Sbjct: 153 VGAAYGVSIGQMFYGESMFARVPDASKIALAYLVHFLRNHDVSMIDCQQETSHLATLGAA 212

Query: 157 EITHVQYAKLLENALKHPEIS 177
            I   ++   L  A+  P+IS
Sbjct: 213 PIARTEFISRLRQAVSGPQIS 233


>gi|75907955|ref|YP_322251.1| leucyl/phenylalanyl-tRNA--protein transferase [Anabaena variabilis
           ATCC 29413]
 gi|119367688|sp|Q3MCD0|LFTR_ANAVT RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|75701680|gb|ABA21356.1| Leucyl/phenylalanyl-tRNA--protein transferase [Anabaena variabilis
           ATCC 29413]
          Length = 191

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (57%), Gaps = 7/172 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  +   + W     R +IPL E F  PK L++ + +E + + IN  F +V++ CA  
Sbjct: 19  MADDNDC--LGWYGSRDRTLIPLDERFRYPKSLQRVLNQERFTVAINRDFAAVVAGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R +TWI+  +Q+ Y  L   GYA++ E W+ + L GG+ G+ +G  F GESMF  + 
Sbjct: 75  --NRESTWISQELQEIYWLLHQTGYAYSFETWQGEELAGGILGIVIGGAFIGESMFYRIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
             SK+ +  LV+ L++R+F++ D Q +  HL +FGA  I   +Y  LLE AL
Sbjct: 133 EGSKVAMVKLVERLRQREFVMFDAQMMNPHLERFGAYRIKDKEYKTLLEKAL 184


>gi|2653653|gb|AAB87633.1| leucyl/phenylalanyl-tRNA-protein transferase [Vibrio cholerae]
          Length = 207

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 82/149 (55%), Gaps = 1/149 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +     F   K +KK+ R+  Y + +N A   VI  CA  T+     W+N
Sbjct: 58  ILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCA-LTRPADQRWLN 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
            +++ AY +L   G  H++E W+ + LVGGLYG+S+G +F GESMFS   NASKI L + 
Sbjct: 117 DSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYF 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
             H  + Q  L+D Q +  HL+  GA  +
Sbjct: 177 CDHFSRHQGQLIDCQVMNPHLQSLGATTL 205


>gi|187929010|ref|YP_001899497.1| leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia pickettii
           12J]
 gi|226737711|sp|B2UFW4|LFTR_RALPJ RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|187725900|gb|ACD27065.1| leucyl/phenylalanyl-tRNA/protein transferase [Ralstonia pickettii
           12J]
          Length = 248

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  E F      +K +RR L    ++IRI+ AF   + ACA  T
Sbjct: 52  AQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPAWEIRIDHAFRETMVACA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWHAGQRVGGLYGVALGRMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  +   ++D Q  T HL   G   +    +   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGGQGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASAPAI 228


>gi|85544477|pdb|2CXA|A Chain A, Crystal Structure Of LeucylPHENYLALANYL-Trna Protein
           Transferase From Escherichia Coli
          Length = 256

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 82/158 (51%), Gaps = 2/158 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E+ H  +  K++ +R  Y +  N AF  VI  CA   ++   TWI 
Sbjct: 73  ILWWSPDPRAVLWPESLHISRSXKRFHKRSPYRVTXNYAFGQVIEGCASDREE--GTWIT 130

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L  +G+AH+IE W++D LVGG YGV+ G +F GES FS  ENASK  L   
Sbjct: 131 RGVVEAYHRLHELGHAHSIEVWREDELVGGXYGVAQGTLFCGESXFSRXENASKTALLVF 190

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            +        L+D Q + +H    GA EI    Y   L
Sbjct: 191 CEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYL 228


>gi|326798581|ref|YP_004316400.1| leucyl/phenylalanyl-tRNA/protein transferase [Sphingobacterium sp.
           21]
 gi|326549345|gb|ADZ77730.1| leucyl/phenylalanyl-tRNA/protein transferase [Sphingobacterium sp.
           21]
          Length = 213

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 89/166 (53%), Gaps = 7/166 (4%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPT 65
           S  I W  P  R I+  +     K ++K +R   Y I  N+AF  VI  CA   +K +  
Sbjct: 50  STPILWYAPPNRFILLPQDLRISKSMRKELRSNSYRITYNSAFAQVIRHCASSPRKGQQG 109

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGA---VFFGESMFSHMENAS 122
           TWI   +Q AYI+L   G+A ++E WKK+ LVGGLYGV  G    VF GESMFS   NAS
Sbjct: 110 TWITEDMQTAYINLHQEGFAMSVEVWKKEQLVGGLYGVICGKRNHVFCGESMFSLAPNAS 169

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           K+ L  L       +F L+D Q  + HLR  GA  I    Y +LL+
Sbjct: 170 KLALIELC---TSNRFELIDCQIESEHLRSMGAKVIPAKSYYQLLQ 212


>gi|332180264|gb|AEE15952.1| Leucyl/phenylalanyl-tRNA--protein transferase [Treponema
           brennaborense DSM 12168]
          Length = 238

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 87/169 (51%), Gaps = 1/169 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            + + W  P  R ++     H P RL+++++R  Y    +  FE+VI+ CA  +   +  
Sbjct: 53  GEPVVWWSPDPRFVLLPGELHVPDRLERFLKRTPYRYTFDVDFEAVITGCANVRRPGQAG 112

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   I  AY  L   G AH++E W+ D L GGLYGV +G VF GESMFS   +++K  
Sbjct: 113 TWIGPKIIDAYCRLHREGIAHSVEVWRGDTLAGGLYGVLIGRVFCGESMFSLESDSAKSA 172

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               V+        L+D Q  T++L +FGA  ++   + +L    L  P
Sbjct: 173 FVLFVRAFASCGGALIDSQVYTDNLARFGAKNVSRAAFLRLERELLPQP 221


>gi|254412930|ref|ZP_05026702.1| leucyl/phenylalanyl-tRNA--protein transferase [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180094|gb|EDX75086.1| leucyl/phenylalanyl-tRNA--protein transferase [Microcoleus
           chthonoplastes PCC 7420]
          Length = 195

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 99/174 (56%), Gaps = 7/174 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD   S  + W    +R IIPL E F  PK L++ + ++ +   IN  F+ V++ CA  
Sbjct: 19  MADETGS--LGWYSSRQRAIIPLDERFRYPKSLQRVLNQKRFSTAINRDFKGVVAGCA-- 74

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R +TWI+  +Q+ Y  L+  G+A++ E W+ + L GG+ G+ +G  F GESMF  + 
Sbjct: 75  --NRESTWISPELQEIYWLLYQEGWAYSFETWQGNELAGGILGIVIGGAFIGESMFYRIP 132

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
             SK+ L  LV+ L+ R FLL D+Q +  HL +FGA  I   +Y  LL  AL+ 
Sbjct: 133 EGSKVALVTLVERLRSRGFLLFDVQMMNPHLARFGAGTIEEQKYQVLLRQALRR 186


>gi|329894890|ref|ZP_08270689.1| Leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium IMCC3088]
 gi|328922619|gb|EGG29954.1| Leucyl/phenylalanyl-tRNA--protein transferase [gamma
           proteobacterium IMCC3088]
          Length = 228

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 87/163 (53%), Gaps = 1/163 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + I W  P  R ++        K LKK +R+  Y + +N AF  V+  CA    +  
Sbjct: 44  SDGEPILWWTPDPRCVLLPNQIRVSKSLKKRLRKP-YTVTVNRAFAQVMLHCATVDGRID 102

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  + +AY +L  +GYAH+IE W    L+GGLYG+ LG VFFGESMFS   + SKI
Sbjct: 103 NTWISQEMHQAYNELHRLGYAHSIEVWLDAELIGGLYGLRLGRVFFGESMFSRATDGSKI 162

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
            LT L     K    L+D Q    HL   GA  +  + + ++L
Sbjct: 163 ALTALAVLCSKAGVNLIDCQVENPHLMSMGASLLPRLDFERIL 205


>gi|183598329|ref|ZP_02959822.1| hypothetical protein PROSTU_01720 [Providencia stuartii ATCC 25827]
 gi|188020504|gb|EDU58544.1| hypothetical protein PROSTU_01720 [Providencia stuartii ATCC 25827]
          Length = 233

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 87/156 (55%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++ +   H  + +KK +R++ Y + +N AF+ VI+ACA + +    TWI   
Sbjct: 56  WWSPDPRAVLMVGELHISRSMKKLLRKQKYRVTVNHAFKDVIAACAIRDE---GTWILPE 112

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           +++ Y  L   G AH+IEAW  + LVGGLYGV++G +F GESMFS M +ASK        
Sbjct: 113 VREGYQALHEQGIAHSIEAWYGEELVGGLYGVNMGHLFCGESMFSRMNDASKFAFITFYF 172

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q + +H    GA EI+   +  +L
Sbjct: 173 HFLRYNGQLFDCQVLNHHTASLGAKEISRRDFLHIL 208


>gi|297564860|ref|YP_003683832.1| leucyl/phenylalanyl-tRNA/protein transferase [Meiothermus silvanus
           DSM 9946]
 gi|296849309|gb|ADH62324.1| leucyl/phenylalanyl-tRNA/protein transferase [Meiothermus silvanus
           DSM 9946]
          Length = 198

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 97/159 (61%), Gaps = 2/159 (1%)

Query: 18  RGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT-TWINMTIQKA 75
           R ++PL E FH P+ L++ +    ++IRIN  F  V+  CA +     + TW+   + + 
Sbjct: 36  RALMPLDERFHVPRSLRRALNSGRFEIRINADFMGVVEGCATRGWSYSSETWLTPELAQM 95

Query: 76  YIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKK 135
           Y+ L   G+AH+ E+W +  L GG+ G++LG  F G+SMF  + +ASK+ L  LV+HL++
Sbjct: 96  YLRLHRAGFAHSFESWYRGELAGGILGLALGGAFIGDSMFYAVADASKVALVRLVEHLRQ 155

Query: 136 RQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           R FLL D+Q    HL +FGA E++  +Y + L+ AL  P
Sbjct: 156 RGFLLFDVQVQNPHLERFGAYEVSPREYRRRLQEALARP 194


>gi|299066627|emb|CBJ37818.1| leucyl, phenylalanyl-tRNA-protein transferase [Ralstonia
           solanacearum CMR15]
          Length = 248

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL----YDIRINTAFESVISACAQKT 60
           A  Q + W     R ++  + F      +K +RR L    ++IRI+ AF  V+  CA  T
Sbjct: 52  AQGQPVLWWNTDPRMVLRPDDFRVSTTFRKTLRRVLDDPTWEIRIDHAFRDVMVDCA--T 109

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   + +AY  L   GYAH++E W     VGGLYGV+LG +F+GESMF+H
Sbjct: 110 TARPGQHGTWITEDVIQAYTALHRRGYAHSVETWHGGRRVGGLYGVALGHMFYGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
             +ASKI L  L   L  R   ++D Q  T HL   G   +    +   +  A   P I
Sbjct: 170 RTDASKIALAALCAFLGSRGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASAPAI 228


>gi|94269699|ref|ZP_01291538.1| Leucyltransferase [delta proteobacterium MLMS-1]
 gi|93451114|gb|EAT02049.1| Leucyltransferase [delta proteobacterium MLMS-1]
          Length = 216

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 92/169 (54%), Gaps = 1/169 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           +  + I W  P  R ++    F   +RL + +R+  + +  N  F +VI ACA+ +   +
Sbjct: 48  SPGEPILWWAPDPRLVLLPGEFQGGRRLARKLRQGCFSVSYNDDFVAVIRACAEIQRPGQ 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             +W++  +  AY  L   GYAH++E  +  VLVGGLYGV LG +FFGESMFS + +ASK
Sbjct: 108 QGSWLDQAMIDAYCRLHEQGYAHSVECRRDGVLVGGLYGVRLGRIFFGESMFSRVADASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
             L  LV  L +    L+D Q  ++HL + GA  +    + + L   +K
Sbjct: 168 AALARLVADLVREDCSLIDCQVPSDHLLRLGARLVPGRAFQQALAMGIK 216


>gi|222110981|ref|YP_002553245.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidovorax ebreus
           TPSY]
 gi|221730425|gb|ACM33245.1| leucyl/phenylalanyl-tRNA/protein transferase [Acidovorax ebreus
           TPSY]
          Length = 250

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKT 60
           +  Q I W  P  R ++ ++ F   + L++ ++R       ++RI++ F +VI ACA K 
Sbjct: 55  STGQPILWWSPDPRMVLHVQEFRLHRSLRRVLQRFRATPGCEVRIDSDFSAVIHACANKP 114

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI  ++  AY  L   G+AH++E W    LVGGLY V+LG   FGESMF+H  
Sbjct: 115 RAGQSGTWIVPSMVAAYEALHAAGHAHSVETWVNGQLVGGLYCVALGRAVFGESMFAHAT 174

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV   ++    L+D Q  T HL   GA E+   Q+   +  A + P  ++
Sbjct: 175 DASKIALAALVCLCRREGVPLIDCQQNTGHLASLGAREMERSQFLNHVARARQDPACTW 233


>gi|21231417|ref|NP_637334.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768529|ref|YP_243291.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|33301300|sp|Q8P996|LFTR_XANCP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|81305499|sp|Q4UUK2|LFTR_XANC8 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|21113085|gb|AAM41258.1| leucyl/phenylalanyl-tRNA-protein transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573861|gb|AAY49271.1| leucyl/phenylalanyl-tRNA-protein transferase [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 249

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 93/174 (53%), Gaps = 5/174 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ Q + W  P  R +   +  H   R ++ +R   + +R +TAF  VI+ACA     RP
Sbjct: 55  SDGQPLLWWSPNPRTVFRTDAIHLSSRFRRQLRTCTWTLRADTAFAQVIAACA--LSPRP 112

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AY+DL   GYAH++E +    LVGG+YGV++G +FFGESMFS     
Sbjct: 113 GQDGTWITDQMQEAYLDLHRRGYAHSVEVFDGARLVGGIYGVAIGQMFFGESMFSGASGG 172

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
           SKI L  L   L    + L+D Q    HL + GA  +   Q+ + +   +  PE
Sbjct: 173 SKIALAALAAELHGLGWPLIDAQVENPHLMRLGAQRLQREQFLQHVATQVALPE 226


>gi|94263862|ref|ZP_01287667.1| Leucyltransferase [delta proteobacterium MLMS-1]
 gi|93455783|gb|EAT05954.1| Leucyltransferase [delta proteobacterium MLMS-1]
          Length = 216

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 92/169 (54%), Gaps = 1/169 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           +  + I W  P  R ++    F   +RL + +R+  + +  N  F +VI ACA+ +   +
Sbjct: 48  SPGEPILWWAPDPRLVLLPGEFQGGRRLARKLRQGCFSVSYNDDFVAVIRACAEIQRHGQ 107

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             +W++  +  AY  L   GYAH++E  +  VLVGGLYGV LG +FFGESMFS + +ASK
Sbjct: 108 QGSWLDQAMIDAYCRLHEQGYAHSVECRRDGVLVGGLYGVRLGRIFFGESMFSRVADASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
             L  LV  L +    L+D Q  ++HL + GA  +    + + L   +K
Sbjct: 168 AALARLVADLVREDCSLIDCQVPSDHLLRLGARLVPGRAFQQALAMGIK 216


>gi|78047608|ref|YP_363783.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|119368218|sp|Q3BTY0|LFTR_XANC5 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|78036038|emb|CAJ23729.1| Leucyltransferase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 250

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 93/179 (51%), Gaps = 7/179 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R +   +      R K+ +R   + +R +TAFE VI ACA     RP
Sbjct: 56  SEGQPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACA--ASPRP 113

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AYI L  +G+AH+IE +    LVGG+YGV++G +FFGESMFS     
Sbjct: 114 GQDGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGVAIGRMFFGESMFSGESGG 173

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN--ALKHPEISF 178
           SK+ L  L  +L  R + L+D Q    HL   GA  +    +   ++   AL  P  S+
Sbjct: 174 SKVALAALAANLHGRGWPLIDAQVENPHLLSLGAERLPRADFLHQVQRQVALTEPPGSW 232


>gi|314964047|gb|EFT08147.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL082PA1]
          Length = 243

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 93/168 (55%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI+ 
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIDN 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|307721667|ref|YP_003892807.1| leucyl/phenylalanyl-tRNA/protein transferase [Sulfurimonas
           autotrophica DSM 16294]
 gi|306979760|gb|ADN09795.1| leucyl/phenylalanyl-tRNA/protein transferase [Sulfurimonas
           autotrophica DSM 16294]
          Length = 230

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 94/159 (59%), Gaps = 3/159 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W     R I+ L+ F   + LKK +++  +D + +T FE V+  CA  K + +  TWI
Sbjct: 54  ILWWSTNPRLIMELDDFKLRRSLKKNLKK--FDYKFDTNFEEVMKKCASTKREGQNGTWI 111

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           N  + +++  L  MG AH++E+++   LVGGLYG+ +G VF GESMF+H+ +ASK     
Sbjct: 112 NKDLVESFSVLHGMGIAHSVESYQDGNLVGGLYGLVIGRVFCGESMFTHVNDASKAAYAV 171

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           LVKHLK   +  +D Q  T HL+  GA E++   Y + L
Sbjct: 172 LVKHLKVWGYDFIDCQVPTQHLKSLGAKEVSRDYYLERL 210


>gi|313794150|gb|EFS42170.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL110PA1]
 gi|313803273|gb|EFS44469.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL110PA2]
 gi|313839196|gb|EFS76910.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL086PA1]
 gi|315078293|gb|EFT50332.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL053PA2]
 gi|327457583|gb|EGF04238.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL092PA1]
          Length = 243

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 93/168 (55%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI+ 
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIDD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|327334398|gb|EGE76109.1| leucyltransferase [Propionibacterium acnes HL097PA1]
          Length = 243

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 93/168 (55%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI+ 
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIDD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRTEYLALLSDALERP 217


>gi|297538794|ref|YP_003674563.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylotenera sp.
           301]
 gi|297258141|gb|ADI29986.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylotenera sp.
           301]
          Length = 233

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 97/172 (56%), Gaps = 8/172 (4%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-----KTQ 61
            + + W  P  R ++  +       L+K ++++ +++R NT F +V++AC+      K  
Sbjct: 62  DEPVMWWSPSPRMVLFPDELKISNSLRKTLKKQPFEVRFNTNFSAVMTACSNTPRLDKNN 121

Query: 62  KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI+  +  AY +L  +GYA ++E+W  + LVGG YGV +G +F+GESMF H+ +A
Sbjct: 122 NPAGTWISHEMIAAYSELNRLGYAISMESWLDNQLVGGCYGVKIGHMFYGESMFHHLTDA 181

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITH---VQYAKLLENA 170
           SK+   HLV++L+ +   L+D Q  T  L  F   EI     +Q+ K L +A
Sbjct: 182 SKVAFVHLVRYLQTQNVGLIDCQMKTPLLASFDGREIERDLFIQHLKFLVSA 233


>gi|313813958|gb|EFS51672.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL025PA1]
          Length = 243

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 93/168 (55%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI+ 
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIDD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|121594344|ref|YP_986240.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidovorax sp. JS42]
 gi|120606424|gb|ABM42164.1| Leucyltransferase [Acidovorax sp. JS42]
          Length = 254

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 97/179 (54%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKT 60
           +  Q I W  P  R ++ ++ F   + L++ ++R       ++RI++ F +VI ACA K 
Sbjct: 59  STGQPILWWSPDPRMVLHVQEFRLHRSLRRVLQRFRATPGCEVRIDSDFSAVIHACANKP 118

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI  ++  AY  L   G+AH++E W    LVGGLY V+LG   FGESMF+H  
Sbjct: 119 RAGQSGTWIVPSMVAAYEALHAAGHAHSVETWVNGQLVGGLYCVALGRAVFGESMFAHAT 178

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV   ++    L+D Q  T HL   GA E+   Q+   +  A + P  ++
Sbjct: 179 DASKIALAALVCLCRREGVRLIDCQQNTGHLASLGAREMERSQFLNHVARARQDPACTW 237


>gi|314921982|gb|EFS85813.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL001PA1]
          Length = 243

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (54%), Gaps = 23/174 (13%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRREL------YDIRINTAFESVISACAQKTQKRP 64
           +W  PLRRGI+       P RLK  + R L      +   ++ AF+ VI+ CA  T  RP
Sbjct: 57  AWWSPLRRGIL------LPGRLK--VARSLRKTTKHHTTTVDRAFDEVITRCADPT--RP 106

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---N 120
             WI+  + + Y  L   G+AH++E W  +  LVGGLYGV++G  F GESMF  +E   +
Sbjct: 107 YAWIDDRVMEVYRYLHDRGWAHSVETWDAQGRLVGGLYGVNVGGFFSGESMFHDLEYGRD 166

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK  L  LV  L      LLD+Q+ T HL   G IE+   +Y  LL +AL+ P
Sbjct: 167 ASKTALMRLVCELGPG---LLDVQWSTPHLASLGVIEVDRAEYLALLSDALERP 217


>gi|288941986|ref|YP_003444226.1| leucyl/phenylalanyl-tRNA/protein transferase [Allochromatium
           vinosum DSM 180]
 gi|288897358|gb|ADC63194.1| leucyl/phenylalanyl-tRNA/protein transferase [Allochromatium
           vinosum DSM 180]
          Length = 247

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 88/165 (53%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R I+  E FH  + L+K +RR      ++  F  VI  C++       TW+ 
Sbjct: 56  ILWWSPDPRAILIPERFHGSRSLRKRLRRGDLVTTLDRDFAGVIQGCSEPRDAEDGTWLV 115

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L  +G AH++E W+   LVGGLYGV++G  FFGESMFS + +ASK+ L  L
Sbjct: 116 PEMVAAYRQLHALGLAHSVEVWRAGELVGGLYGVAIGRAFFGESMFSRVSDASKVALARL 175

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
            + L   +F ++D Q  T HL   GA E+   ++  LL+     P
Sbjct: 176 CEQLWDWEFGVIDCQMTTGHLLSLGAFEVPRAEFLTLLDRHGARP 220


>gi|82523953|emb|CAI78764.1| Leucyl/phenylalanyl-tRNA protein transferase [uncultured epsilon
           proteobacterium]
          Length = 229

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 94/165 (56%), Gaps = 3/165 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           A +  I W  P  R I+ L+ F   + LKK +++  ++ + +T F  VI+ C  K +   
Sbjct: 48  AKNDPILWWSPNPRLIMELDDFKLSRSLKKSMKK--FEYKFDTNFTKVITRCGLKQRNNQ 105

Query: 65  T-TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   I +AY  L  MG  H+IE++K + LVGGLYG+ +G VF GESMF+ + +ASK
Sbjct: 106 NGTWIQKDIIEAYETLHGMGVVHSIESYKDNKLVGGLYGLVVGKVFCGESMFADVNDASK 165

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
                L+KHLK+  +  +D Q  T HL+  GA E++   +   LE
Sbjct: 166 AAYYVLIKHLKEWGYDFIDCQVPTEHLKSLGAKEVSREYFLNRLE 210


>gi|281422656|ref|ZP_06253655.1| leucyltransferase [Prevotella copri DSM 18205]
 gi|281403326|gb|EFB34006.1| leucyltransferase [Prevotella copri DSM 18205]
          Length = 221

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 94/166 (56%), Gaps = 4/166 (2%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK--R 63
           +  +I W  P++R +I  +  H    ++  +R+  Y + IN  F+ VI  C++   +   
Sbjct: 53  DQPEILWFCPMKRFVIFPDEIHISHSMRTLMRKNRYSVGINEDFDGVIRGCSKNNGRYWE 112

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAW--KKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
              W+   I +A+  L   G+A ++E W  + D LVGGLYGV++G VF GESMFS + +A
Sbjct: 113 DGAWLGENIIQAFTALHKQGFAASVEVWDNETDELVGGLYGVTIGKVFIGESMFSRVPSA 172

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           SKI L  L ++L++    ++D Q  T HL+  G   I++ +Y K++
Sbjct: 173 SKIALIFLARYLQEHGGKMIDCQLETPHLKSMGGRYISYEEYMKIM 218


>gi|170727041|ref|YP_001761067.1| leucyl/phenylalanyl-tRNA--protein transferase [Shewanella woodyi
           ATCC 51908]
 gi|226737724|sp|B1KIC1|LFTR_SHEWM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|169812388|gb|ACA86972.1| Leucyltransferase [Shewanella woodyi ATCC 51908]
          Length = 236

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 86/159 (54%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R +       T + L K+++++ +   IN AF  VI  CA     +  TWI 
Sbjct: 57  ILWWSPDPRAVFVPGNMKTSRSLLKHLKKQPWRYSINHAFSQVIEGCAAPRSSQDGTWIT 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             IQ AY+ L  +G AH+IE W +D L+GGLYG++ G VF GESMF    NASK  +  L
Sbjct: 117 PEIQDAYLKLHELGKAHSIEVWHQDELIGGLYGLATGQVFCGESMFHTQTNASKAAMLLL 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
            +HL K+ F L+D Q +  HL   GA  +    +  LL+
Sbjct: 177 HQHLLKQGFKLIDAQVMNPHLASLGATALRRKDFINLLK 215


>gi|332039972|gb|EGI76361.1| leucyl/phenylalanyl-tRNA--protein transferase [Hylemonella gracilis
           ATCC 19624]
          Length = 262

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 83/146 (56%), Gaps = 1/146 (0%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTI 88
           K L++++     DIRI+TAF+ V++ACA   +  +  TWI   +++AY DL   G+AH+I
Sbjct: 95  KTLQRFMADPACDIRIDTAFDEVVAACAGSPRPGQDGTWITPAMRRAYADLHRAGHAHSI 154

Query: 89  EAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITN 148
           E W    L GGLY VSLG   +GESMF+   +ASKI L+ LV   +     L+D Q  T 
Sbjct: 155 ETWIAGELRGGLYCVSLGRAVYGESMFARSTDASKIALSALVAFCRSNGIGLVDCQQNTA 214

Query: 149 HLRQFGAIEITHVQYAKLLENALKHP 174
           HL   GA  I   Q+ + L  A   P
Sbjct: 215 HLASLGARPIPRNQFLQHLAKARDLP 240


>gi|295395948|ref|ZP_06806133.1| leucyltransferase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971221|gb|EFG47111.1| leucyltransferase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 212

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 87/174 (50%), Gaps = 6/174 (3%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
            S  I W  P+RRG +        K L+K +RR  +    + AF  V+ ACA     RP 
Sbjct: 35  GSGPIGWWSPVRRGALLPGDLRVSKSLRKSMRR--FTFSCDNAFPEVVDACADP--DRPG 90

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
            WI   I+  Y  L  +  AH++E W+   LVGGLYGV LG +F GESMF  + +ASK  
Sbjct: 91  AWITPDIRDLYCKLHDLDVAHSVEVWRDGCLVGGLYGVWLGRLFAGESMFHRVTDASKAA 150

Query: 126 LTHLVKHLKKR--QFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           L  LV+ L        ++D Q+ T HL   G  ++   +Y   LE AL   + S
Sbjct: 151 LVELVRTLDAECGDTWIIDTQWQTPHLASLGVSQMWAGEYRDRLELALHDVDFS 204


>gi|330825452|ref|YP_004388755.1| Leucyl/phenylalanyl-tRNA--protein transferase [Alicycliphilus
           denitrificans K601]
 gi|329310824|gb|AEB85239.1| Leucyl/phenylalanyl-tRNA--protein transferase [Alicycliphilus
           denitrificans K601]
          Length = 250

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 93/177 (52%), Gaps = 5/177 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKTQK 62
            Q I W  P  R ++ ++ F   + L++ ++R       ++RI++ F +VI ACAQ  + 
Sbjct: 57  GQPILWWSPDPRMVLHVQEFRLHRSLRRVLQRFRATPGCEVRIDSDFPAVIRACAQTPRA 116

Query: 63  -RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +  TWI   +  AY  L   G+AH++E W    L GGLY V+LG   FGESMF+H  +A
Sbjct: 117 GQDGTWIVPRMVAAYEALHAAGHAHSVETWVDGRLAGGLYCVALGRAVFGESMFAHATDA 176

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           SKI L  LV   ++    L+D Q  T HL   GA EI   Q+ + +  A   P   +
Sbjct: 177 SKIALAALVCLCRREGVALIDCQQNTGHLASLGAREIGRAQFLRHVAQARAEPPCDW 233


>gi|260906806|ref|ZP_05915128.1| leucyl/phenylalanyl-tRNA--protein transferase [Brevibacterium
           linens BL2]
          Length = 234

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 97/196 (49%), Gaps = 31/196 (15%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           S  +  + W  P RRG++        K L+K +R   ++  +NT FE VI ACA  +  R
Sbjct: 33  SGGTGRMGWWGPRRRGVLLPGDLKVSKSLRKSMRH--FECSVNTGFEHVIRACADPS--R 88

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           P +WI   I   Y+ L   G+AH++E   + +LVGGLYGV++G+ F GESMF    +ASK
Sbjct: 89  PGSWITEDIISLYLGLHKDGWAHSVEIRSEGILVGGLYGVAMGSFFAGESMFHTRRDASK 148

Query: 124 ICLTHLVK---------------------------HLKKRQFLLLDIQFITNHLRQFGAI 156
             L HLV                            +       L+D Q+ T+HL   G  
Sbjct: 149 AALVHLVSLFDETLDNHPSEPGAKNAVSSAPTSIDNDDDHHRWLIDTQWQTSHLASLGVS 208

Query: 157 EITHVQYAKLLENALK 172
           EI+ ++Y+  L++AL+
Sbjct: 209 EISGLEYSTRLDSALR 224


>gi|221134869|ref|ZP_03561172.1| leucyl/phenylalanyl-tRNA--protein transferase [Glaciecola sp.
           HTCC2999]
          Length = 245

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 92/179 (51%), Gaps = 14/179 (7%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
           SAN + I W  P  RG++PL+  +  K  +K++ +  + I IN AF++VI+ACA    + 
Sbjct: 52  SAN-EPILWWSPDPRGVLPLDALYISKTTRKWLNKSQHSITINHAFDAVITACA-AIPRG 109

Query: 64  P-----------TTWINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFG 111
           P            TWI  T+  AY  L     AH+IE W     LVGGLYG+ L  VF G
Sbjct: 110 PIVHDDGSIVENGTWITQTMVNAYQSLHKAKLAHSIEIWDPSGQLVGGLYGIGLNGVFCG 169

Query: 112 ESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           ESMF    N SK+    LV H+++     +D Q    +L   G IE++   Y K L +A
Sbjct: 170 ESMFHTQANTSKLAFIALVHHMQQYNGAFIDCQMQNPYLASMGVIEVSRHDYLKQLHSA 228


>gi|253688101|ref|YP_003017291.1| leucyl/phenylalanyl-tRNA/protein transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259494908|sp|C6DF46|LFTR_PECCP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|251754679|gb|ACT12755.1| leucyl/phenylalanyl-tRNA/protein transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 234

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 83/161 (51%), Gaps = 2/161 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++  +  H  + +KK+++R  +   +N AF+ VI ACA +      T
Sbjct: 53  GEPILWWSPNPRAVLFPDELHVSRSMKKFLKRHTFHATLNQAFDDVIHACAHEHHD--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AY  L   G AH++E W+ D LVGGLYGV  G +F GESMFS  +NASK  L
Sbjct: 111 WITSEIISAYRQLHLAGKAHSVEVWQDDKLVGGLYGVEQGRLFCGESMFSRTDNASKYAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               +H       L+D Q +  H    G  EI   ++ + L
Sbjct: 171 LAFQQHFIHHGGHLIDCQVLNAHTASLGVSEIPRDRFLQQL 211


>gi|295131742|ref|YP_003582405.1| leucyltransferase [Propionibacterium acnes SK137]
 gi|291376180|gb|ADE00035.1| leucyltransferase [Propionibacterium acnes SK137]
          Length = 243

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 92/168 (54%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|50843656|ref|YP_056883.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes KPA171202]
 gi|289425911|ref|ZP_06427663.1| leucyltransferase [Propionibacterium acnes SK187]
 gi|50841258|gb|AAT83925.1| leucyl/phenylalanyl-tRNA-protein transferase [Propionibacterium
           acnes KPA171202]
 gi|289153687|gb|EFD02396.1| leucyltransferase [Propionibacterium acnes SK187]
 gi|313765174|gb|EFS36538.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL013PA1]
 gi|313817101|gb|EFS54815.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL059PA1]
 gi|313829286|gb|EFS67000.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL063PA2]
 gi|314916821|gb|EFS80652.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL005PA4]
 gi|314918998|gb|EFS82829.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL050PA1]
 gi|314921171|gb|EFS85002.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL050PA3]
 gi|314932482|gb|EFS96313.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL067PA1]
 gi|314958682|gb|EFT02784.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL002PA1]
 gi|314968814|gb|EFT12912.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL037PA1]
 gi|315081399|gb|EFT53375.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL078PA1]
 gi|315100035|gb|EFT72011.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL059PA2]
 gi|315102804|gb|EFT74780.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL046PA1]
 gi|315107359|gb|EFT79335.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL030PA1]
 gi|315110493|gb|EFT82469.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL030PA2]
 gi|327455508|gb|EGF02163.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL087PA3]
 gi|328756829|gb|EGF70445.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL087PA1]
 gi|328759109|gb|EGF72725.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL025PA2]
          Length = 243

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 92/168 (54%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|313808608|gb|EFS47068.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL087PA2]
 gi|313819048|gb|EFS56762.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL046PA2]
 gi|313821675|gb|EFS59389.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL036PA1]
 gi|313823811|gb|EFS61525.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL036PA2]
 gi|313826914|gb|EFS64628.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL063PA1]
 gi|314926150|gb|EFS89981.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL036PA3]
 gi|314960989|gb|EFT05090.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL002PA2]
 gi|314979054|gb|EFT23148.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL072PA2]
 gi|314985967|gb|EFT30059.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL005PA2]
 gi|314989274|gb|EFT33365.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL005PA3]
 gi|315084961|gb|EFT56937.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL027PA2]
 gi|315087492|gb|EFT59468.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL002PA3]
 gi|315089600|gb|EFT61576.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL072PA1]
 gi|327333977|gb|EGE75692.1| leucyltransferase [Propionibacterium acnes HL096PA3]
 gi|328757716|gb|EGF71332.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL020PA1]
          Length = 243

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 92/168 (54%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|160900290|ref|YP_001565872.1| leucyl/phenylalanyl-tRNA--protein transferase [Delftia acidovorans
           SPH-1]
 gi|160365874|gb|ABX37487.1| Leucyltransferase [Delftia acidovorans SPH-1]
          Length = 282

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (52%), Gaps = 5/179 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKT 60
           +  Q   W  P  R ++    F   + L+K ++R       +IRI++AFE+V+  CAQ  
Sbjct: 76  SEGQPTLWWSPDPRMVLQTSQFRLHRSLRKTLQRFRATPGCEIRIDSAFETVMQHCAQTV 135

Query: 61  Q-KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI   I  AY DL + G AH++E W    LVGGLY V+LG   FGESMF+H  
Sbjct: 136 RHDQDGTWIVQEILDAYTDLHHQGAAHSVETWVDGRLVGGLYCVALGRAVFGESMFAHAT 195

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           +ASKI L  LV   + +    +D Q  T HL   GA E+   ++ + +    + P + +
Sbjct: 196 DASKIALAALVALCRHQGAAQIDCQQATQHLASLGAREMPRARFLQTVAEQSQLPPMRW 254


>gi|289427936|ref|ZP_06429640.1| leucyltransferase [Propionibacterium acnes J165]
 gi|289158819|gb|EFD07019.1| leucyltransferase [Propionibacterium acnes J165]
          Length = 232

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 93/172 (54%), Gaps = 11/172 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 46  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 101

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 102 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 161

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P   +
Sbjct: 162 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERPSPQW 210


>gi|261339223|ref|ZP_05967081.1| hypothetical protein ENTCAN_05454 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319075|gb|EFC58013.1| leucyltransferase [Enterobacter cancerogenus ATCC 35316]
          Length = 235

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 84/165 (50%), Gaps = 3/165 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
              I W  P  R ++    FH  + +K++  R  Y + +N AF  VI  CA+   +   T
Sbjct: 53  GDPILWWSPDPRAVLWPAQFHLSRSMKRFHARSTYRVTLNHAFGQVIEGCAEDRHE--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           WI   I  AY  L  +GYAH+IE W +   L+GG+YGV+ G +F GESMFS   NASK  
Sbjct: 111 WITRDIITAYHQLHELGYAHSIEVWNEGGELIGGMYGVAQGTLFCGESMFSRAVNASKTA 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           L    +    R   L+D Q + +H    GA+EI    Y + L+  
Sbjct: 171 LLVFCEEFAGRGGKLMDCQVLNDHTASLGAVEIPRRHYIEHLDTC 215


>gi|289666023|ref|ZP_06487604.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 242

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 93/173 (53%), Gaps = 5/173 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +N Q I W  P  R +   +      R K+ +R   + IR +TAFE VI+ACA  +  RP
Sbjct: 48  SNGQPILWWSPDPRMVFRTDALRLSSRFKRQLRSSSWTIRADTAFEQVINACA--SVPRP 105

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AYI L  +G+AH+ E +    L+GG+YGV++G +FFGESMFS     
Sbjct: 106 GQDGTWITAPMQQAYIALHRLGHAHSFEVFDGTHLIGGIYGVAIGQMFFGESMFSVQSGG 165

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           SK+ L  L  +L+   + LLD Q    HL   GA  +    + + +E  +  P
Sbjct: 166 SKVALAALAAYLQAEGWPLLDAQVENPHLLSLGAQRLPRAPFLQQVELQVAQP 218


>gi|24212808|ref|NP_710289.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45656007|ref|YP_000093.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
 gi|33301296|sp|Q8F9T2|LFTR_LEPIN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|52783127|sp|Q72W44|LFTR_LEPIC RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|24193459|gb|AAN47307.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45599240|gb|AAS68730.1| leucyl/phenylalanyl-tRNA-protein transferase [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
          Length = 219

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 91/167 (54%), Gaps = 3/167 (1%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           + Q I W     R I  L   H  KRLK+ I ++ Y I  N AFE V+  CA +  +   
Sbjct: 42  SDQPILWYCLDPRSIFDLNKLHISKRLKRKINQKRYTITFNRAFEQVMRCCAYRPGE--D 99

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASKI 124
           TWI     K+Y +   +GYAH++E W ++  L GG+YG+++G  F GESMFS + +  KI
Sbjct: 100 TWITDLFIKSYTEFHKLGYAHSLEVWDENGKLGGGVYGIAIGNFFAGESMFSFIPDFGKI 159

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            L HL + LKK  F L D Q +       GA +I   +Y K LE+A+
Sbjct: 160 GLFHLFETLKKDHFTLFDTQQLNLVTLSLGAYQIPKKEYLKRLESAV 206


>gi|298370324|ref|ZP_06981640.1| leucyltransferase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281784|gb|EFI23273.1| leucyltransferase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 246

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 89/176 (50%), Gaps = 16/176 (9%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT---TWI 68
           W     R ++  E  H  K L K +R + Y + +N AF  VI+ CA     RP    TWI
Sbjct: 58  WFATAPRTVLLPENIHIGKSLAKTLRGKAYRVTVNQAFVDVIAGCA--AAPRPNQDGTWI 115

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDV-------LVGGLYGVSLGAVFFGESMFSHMENA 121
               Q AY DL  +G+AH+ E W  D        L GGLYGV +G VF+GESMF+   +A
Sbjct: 116 APEFQTAYFDLHRLGFAHSFECWYPDTDDGGRLKLAGGLYGVQIGRVFYGESMFARAPDA 175

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT----HVQYAKLLENALKH 173
           SKI     V  L++    L+D Q  T HL++FG+ ++     H    +L +  LK 
Sbjct: 176 SKIAFACAVPFLERCGVELIDCQQDTEHLKRFGSQQMDFHEFHTALVRLNDMPLKE 231


>gi|294788052|ref|ZP_06753296.1| leucyltransferase [Simonsiella muelleri ATCC 29453]
 gi|294484345|gb|EFG32028.1| leucyltransferase [Simonsiella muelleri ATCC 29453]
          Length = 234

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 86/163 (52%), Gaps = 6/163 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP---TTWI 68
           W     R ++  E     + LKK I+ + Y + +N  F  VI+ CA     RP    TWI
Sbjct: 56  WFSIAPRAVLLPEQLKLSRSLKKSIQNKRYCVSVNQQFAEVIAQCA--ATPRPHQHGTWI 113

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKD-VLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
               Q AY  L  MG+AH+ E + ++  L GGLYGV +G +FFGESMF+H  +ASKI   
Sbjct: 114 APAFQAAYTQLHQMGHAHSFEFYNENNKLTGGLYGVQIGQIFFGESMFAHESDASKIAFA 173

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           H V  L K    L+D Q  T HLR+FG+  +    +   L+N 
Sbjct: 174 HAVPFLAKCGVQLIDCQQDTEHLRRFGSQLMAFNDFQAALKNG 216


>gi|238022481|ref|ZP_04602907.1| hypothetical protein GCWU000324_02389 [Kingella oralis ATCC 51147]
 gi|237867095|gb|EEP68137.1| hypothetical protein GCWU000324_02389 [Kingella oralis ATCC 51147]
          Length = 244

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 6/150 (4%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWINM 70
           W     R ++  E  H  + L K +RR+ Y + +N  F  VI+ACAQ    ++  TWI  
Sbjct: 60  WFAQHPRAVLLPERLHIGRSLAKTLRRKSYRVSVNACFAEVIAACAQIPRAEQGGTWITP 119

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY  L  +G+AH+ E W  D      L GGLYGV +G+VF+GESMF+   +ASKI 
Sbjct: 120 DFQAAYTALHRLGHAHSFECWLPDAAGRWHLAGGLYGVQIGSVFYGESMFARRADASKIA 179

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
               V  L +    L+D Q  T HL +FG+
Sbjct: 180 FACAVPFLARCGIRLIDCQQDTAHLARFGS 209


>gi|42527628|ref|NP_972726.1| leucyl/phenylalanyl-tRNA--protein transferase [Treponema denticola
           ATCC 35405]
 gi|41818456|gb|AAS12645.1| leucyl/phenylalanyl-tRNA--protein transferase [Treponema denticola
           ATCC 35405]
          Length = 246

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 91/162 (56%), Gaps = 2/162 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P  R +I   +FH P RLK+ I++  + I  N AF+ VI  CA  K + +  TWI
Sbjct: 85  IIWFSPSLRFVIDKASFHIPSRLKREIKKTNFKISRNEAFDEVIENCALIKREGQKGTWI 144

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              + +AY  L  +G+AH++EAW+   L GG YG+ +  VF GESMFS +  ASK     
Sbjct: 145 TDDMLQAYRLLHKLGFAHSVEAWRGGELAGGFYGLYINEVFIGESMFSEISGASKTAFAL 204

Query: 129 LVKH-LKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
             +   + ++ +L+D Q  + ++++FG  +I   +Y  +L +
Sbjct: 205 FAQDFFENKKGILIDAQIPSENIKRFGGFKIPRNRYLGILNS 246


>gi|315186427|gb|EFU20187.1| leucyl/phenylalanyl-tRNA/protein transferase [Spirochaeta
           thermophila DSM 6578]
          Length = 279

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 93/166 (56%), Gaps = 1/166 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWI 68
           I W  P  R I+     H  KRL++ +RR  +    + AFE VI ACA   ++ +  TWI
Sbjct: 64  ILWWSPEVRCILWSNDLHISKRLRRDLRRSDFRFSADLAFEQVIHACATVPRRGQEGTWI 123

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AYI L ++GYAH++E W+ + LVGG YGVSLG VFFGESMFS ++NASK  L  
Sbjct: 124 TPEMHDAYIRLHHLGYAHSVEVWRGEALVGGFYGVSLGRVFFGESMFSLVDNASKAALVF 183

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
                 +    L+D Q  T+HL + GA+ +    +   L   L+ P
Sbjct: 184 SRALFLRLGITLVDCQVPTDHLLRMGAVTVPREDFLASLGPLLRTP 229


>gi|58582174|ref|YP_201190.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84624067|ref|YP_451439.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188576735|ref|YP_001913664.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188576926|ref|YP_001913855.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|58426768|gb|AAW75805.1| leucyl-phenylalanyl-tRNA-protein transferase [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84368007|dbj|BAE69165.1| leucyl-phenylalanyl-tRNA-protein transferase [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188521187|gb|ACD59132.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188521378|gb|ACD59323.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 265

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 87/162 (53%), Gaps = 5/162 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + I W  P  R +   +      R K+ +R   + +R +TAFE VI ACA     RP
Sbjct: 71  SDGRPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACA--ASPRP 128

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AYI L  +G+AH+IE +    LVGG+YGV++G +FFGESMFS     
Sbjct: 129 GQDGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGVAVGRMFFGESMFSGESGG 188

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           SK+ L  L   L  R + L+D Q    HL   GA  +   ++
Sbjct: 189 SKVALAALAADLHGRGWPLIDAQVENPHLLSMGAERLPRAEF 230


>gi|282854501|ref|ZP_06263837.1| leucyltransferase [Propionibacterium acnes J139]
 gi|282582362|gb|EFB87743.1| leucyltransferase [Propionibacterium acnes J139]
 gi|314965941|gb|EFT10040.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL082PA2]
 gi|314980738|gb|EFT24832.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL110PA3]
 gi|315090943|gb|EFT62919.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL110PA4]
 gi|315095168|gb|EFT67144.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL060PA1]
 gi|315105285|gb|EFT77261.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL050PA2]
 gi|327328796|gb|EGE70556.1| leucyltransferase [Propionibacterium acnes HL103PA1]
          Length = 243

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 94/174 (54%), Gaps = 23/174 (13%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRREL------YDIRINTAFESVISACAQKTQKRP 64
           +W  PLRRGI+       P RLK  + R L      +   ++ AF+ VI+ CA  T  RP
Sbjct: 57  AWWSPLRRGIL------LPGRLK--VARSLRKTTKHHTTTVDRAFDEVITRCADPT--RP 106

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---N 120
             WI+  + + Y  L   G+AH++E W  +  LVGGLYGV++G  F GESMF   E   +
Sbjct: 107 YAWIDDRVMEVYRYLHDRGWAHSVETWDAQGRLVGGLYGVNVGGFFSGESMFHDPEYGRD 166

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           ASK  L  LV  L      LLD+Q+ T HL   G IE+   +Y  LL +AL+ P
Sbjct: 167 ASKTALMRLVCELGPG---LLDVQWSTPHLASLGVIEVDRAEYLALLSDALERP 217


>gi|285018231|ref|YP_003375942.1| leucyl/phenylalanyl-tRNA--protein transferase (leucyltransferase)
           [Xanthomonas albilineans GPE PC73]
 gi|283473449|emb|CBA15954.1| probable leucyl/phenylalanyl-trna--protein transferase
           (leucyltransferase) [Xanthomonas albilineans]
          Length = 245

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 82/152 (53%), Gaps = 1/152 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           ++ Q I W  P  R +   E      RL++ +R   + +R +TAF  VI ACAQ  +  +
Sbjct: 54  SDGQPILWWSPDPRTVFRSEGVRLSSRLRRGLRHSSWIVRADTAFAQVIDACAQTPRPGQ 113

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   ++ AY+ L   G+AH++E +    LVGGLYGV+ G +FFGESMFS     SK
Sbjct: 114 DGTWITAQMRDAYVTLHRAGHAHSVEVFDGTALVGGLYGVARGRMFFGESMFSARSGGSK 173

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
           + L  L   L +  + L+D Q    HL   GA
Sbjct: 174 VALAALAMRLHEWGWPLIDAQVENPHLLSLGA 205


>gi|218885561|ref|YP_002434882.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218756515|gb|ACL07414.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 277

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 88/164 (53%), Gaps = 1/164 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT-QKRPTTWI 68
           I W  P  R  +  +  H  + L + IR   +++  + AF  VI  CA    Q +  TW+
Sbjct: 57  ILWWSPDPRCALLPDELHVSRSLARCIRSNAFEVTFDKAFALVIRRCAATPRQGQRGTWL 116

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +  AY  L  +G AH+ EAW+   LVGGLYGV+LG VF+GESMF  +  ASK+  T 
Sbjct: 117 VPAMINAYEGLHRLGIAHSAEAWQDGRLVGGLYGVALGGVFYGESMFHLVPEASKVAFTW 176

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           L   L++    L+D Q  T H+ +FGA E+   ++   L + ++
Sbjct: 177 LATWLRQAGCTLIDCQQTTPHMVRFGARELPRPEFLARLADGVR 220


>gi|261821262|ref|YP_003259368.1| leucyl/phenylalanyl-tRNA--protein transferase [Pectobacterium
           wasabiae WPP163]
 gi|261605275|gb|ACX87761.1| leucyl/phenylalanyl-tRNA/protein transferase [Pectobacterium
           wasabiae WPP163]
          Length = 234

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 86/163 (52%), Gaps = 2/163 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R ++    FH  + +KK+++R ++   +N AF+ VI ACA +      T
Sbjct: 53  GEPILWWSPNPRAVLFPGEFHLSRSMKKFLKRHVFIATLNQAFDDVIHACAHEHHD--GT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   I  AY  L  +G AH++E W    LVGGLYG+  G +F GESMFS  +NASK  L
Sbjct: 111 WITPDIISAYRQLHQVGKAHSVEVWHNGALVGGLYGIEQGRLFCGESMFSRTDNASKYAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
               +H  +    L+D Q + +H    G  EI   ++ + L +
Sbjct: 171 LVFQQHFFRHGGQLIDCQVLNSHTASLGVSEIPRDRFLQQLSH 213


>gi|183222564|ref|YP_001840560.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189912599|ref|YP_001964154.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167777275|gb|ABZ95576.1| Leucyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167780986|gb|ABZ99284.1| Leucyl/phenylalanyl-tRNA--protein transferase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 221

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 93/167 (55%), Gaps = 4/167 (2%)

Query: 7   SQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPT 65
           S+D I W     R I  +   H  K + + +R++ + I  N AF  V+ ACA +  ++  
Sbjct: 44  SEDPIRWYSLDPRAIFDINRVHFSKTVLRKVRQKKFRITFNEAFAIVMQACAYR--EKDN 101

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
           TWI       Y++L   G+AH++E W  +++LVGG+YGV++G  F GESMFS   +A KI
Sbjct: 102 TWITPGFIDGYLELHKQGWAHSVEVWNSENILVGGVYGVAIGKFFAGESMFSFESDAGKI 161

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            L HL   L++  F+L D Q + +   Q GA EI  + Y   LE A+
Sbjct: 162 ALYHLFARLRESNFVLFDTQQLNHVTWQLGAYEIPKLSYLDRLERAV 208


>gi|118572943|sp|Q2P2R2|LFTR_XANOM RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|118572944|sp|Q5GZR6|LFTR_XANOR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
          Length = 250

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 87/160 (54%), Gaps = 1/160 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           ++ + I W  P  R +   +      R K+ +R   + +R +TAFE VI ACA   +  +
Sbjct: 56  SDGRPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACAASPRPGQ 115

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   +Q+AYI L  +G+AH+IE +    LVGG+YGV++G +FFGESMFS     SK
Sbjct: 116 DGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGVAVGRMFFGESMFSGESGGSK 175

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           + L  L   L  R + L+D Q    HL   GA  +   ++
Sbjct: 176 VALAALAADLHGRGWPLIDAQVENPHLLSMGAERLPRAEF 215


>gi|194289435|ref|YP_002005342.1| leucyl/phenylalanyl-tRNA--protein transferase [Cupriavidus
           taiwanensis LMG 19424]
 gi|226736121|sp|B3R4T2|LFTR_CUPTR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|193223270|emb|CAQ69275.1| leucyl, phenylalanyl-tRNA-protein transferase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 250

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 92/178 (51%), Gaps = 5/178 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W     R ++          L+K +RR L D    IR++  F +V+ ACA   
Sbjct: 52  SSGQPVLWWSTDPRMVLAPPALRVSVNLRKTLRRVLRDADWEIRVDHDFLAVMRACASTP 111

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   I  AY  L   G AH++E+W +   VGGLYGV+LG +FFGESMF+H  
Sbjct: 112 REGQDGTWITDAIIAAYGALHRNGLAHSVESWYRGERVGGLYGVALGRMFFGESMFAHRT 171

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           +ASKI L  L   L      ++D Q  T+HL   GA  I   ++   +  A   P IS
Sbjct: 172 DASKIALAALCAFLGNHGVAMIDCQQETDHLASLGARPIPRAEFVAHVRAATAQPAIS 229


>gi|282896054|ref|ZP_06304080.1| Leucyl/phenylalanyl-tRNA--like protein transferase [Raphidiopsis
           brookii D9]
 gi|281198972|gb|EFA73847.1| Leucyl/phenylalanyl-tRNA--like protein transferase [Raphidiopsis
           brookii D9]
          Length = 197

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (57%), Gaps = 7/172 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  N   + W +     +IPL+  F  P+ L++ + ++ +  RIN  F  V+  CA  
Sbjct: 25  MADEYNQ--LRWYRSKEHTLIPLDKRFRYPRSLQRVLNQQRFTTRINQDFIGVVRGCA-- 80

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  +Q+ Y  L+  GYA++ E W+ D L GG+ G+ +G  F GESMF H+ 
Sbjct: 81  --NRETTWISPQLQQIYWSLYQAGYAYSFETWQGDQLAGGILGIVIGGAFIGESMFYHIP 138

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            ASK+ +  LV+ L++R+F++ D Q +  HL +FGA  I   +Y  LL  A+
Sbjct: 139 EASKVAMVKLVERLRERRFIVFDAQIMNPHLARFGAYSIHVEEYNTLLGLAI 190


>gi|73541013|ref|YP_295533.1| leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia eutropha
           JMP134]
 gi|119367713|sp|Q472J4|LFTR_RALEJ RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|72118426|gb|AAZ60689.1| Leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia eutropha
           JMP134]
          Length = 250

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 84/149 (56%), Gaps = 1/149 (0%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTI 88
           K L++ +R   ++IR++  F +V+ ACA   ++ +  TWI   I  AY  L   G AH++
Sbjct: 81  KTLRRVLRDPDWEIRVDDDFLAVMRACAMTPREGQDGTWITREIIAAYGALHSNGMAHSV 140

Query: 89  EAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITN 148
           E W +   VGGLYGV+LG +F+GESMF+H  +ASKI L  L   L      ++D Q  T+
Sbjct: 141 ETWYRGTRVGGLYGVALGRMFYGESMFAHRTDASKIALAALCAFLGSHGVPMIDCQQETD 200

Query: 149 HLRQFGAIEITHVQYAKLLENALKHPEIS 177
           HL   GA  I   ++   + NA   P I+
Sbjct: 201 HLASLGARPIARAEFLAHVRNASAQPAIT 229


>gi|319639452|ref|ZP_07994202.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria mucosa
           C102]
 gi|317399347|gb|EFV80018.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria mucosa
           C102]
          Length = 251

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 86/169 (50%), Gaps = 6/169 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E+ H  + L K +R + Y + +N  FE VI+ CA   + ++  TWI  
Sbjct: 62  WYAVAPRAVIVPESLHIGRSLAKTLRNKPYRVTVNCCFEKVIAHCADVPRPEQDGTWIEP 121

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L + GYAH+ E W  D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 122 AFQTAYLKLHHQGYAHSFECWLPDEQGEMQLAGGFYGVQIGCVFYGESMFALRPDASKIA 181

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               V  L      L+D Q  T H+R+FG+  +    +   L++    P
Sbjct: 182 FACAVPFLADLGVALIDCQQDTEHMRRFGSQLMDFADFQTALKDLNAKP 230


>gi|327450350|gb|EGE97004.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL013PA2]
          Length = 243

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 91/168 (54%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 57  AWWSPTRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|319763257|ref|YP_004127194.1| leucyl/phenylalanyl-tRNA/protein transferase [Alicycliphilus
           denitrificans BC]
 gi|317117818|gb|ADV00307.1| leucyl/phenylalanyl-tRNA/protein transferase [Alicycliphilus
           denitrificans BC]
          Length = 250

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 92/177 (51%), Gaps = 5/177 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKTQK 62
            Q I W  P  R ++ ++ F   + L++ ++R       ++RI++ F +VI ACAQ  + 
Sbjct: 57  GQPILWWSPDPRMVLHVQEFRLHRSLRRVLQRFRATPGCEVRIDSDFPAVIRACAQTPRA 116

Query: 63  -RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +  TWI   +  AY  L   G+AH++E W    L GGLY V+LG   FGESMF+H  +A
Sbjct: 117 GQDGTWIVPRMVAAYEALHAAGHAHSVETWVDGRLAGGLYCVALGRAVFGESMFAHATDA 176

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           SKI L  LV   ++    L+D Q  T HL   GA EI   Q+   +  A   P   +
Sbjct: 177 SKIALAALVCLCRREGVALIDCQQNTGHLASLGAREIGRAQFLHHVAQARADPPCDW 233


>gi|313771557|gb|EFS37523.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL074PA1]
 gi|313811956|gb|EFS49670.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL083PA1]
 gi|313832388|gb|EFS70102.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL007PA1]
 gi|313834179|gb|EFS71893.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL056PA1]
 gi|314975055|gb|EFT19150.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL053PA1]
 gi|314977466|gb|EFT21561.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL045PA1]
 gi|314985843|gb|EFT29935.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL005PA1]
 gi|315096904|gb|EFT68880.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL038PA1]
 gi|327332985|gb|EGE74717.1| leucyltransferase [Propionibacterium acnes HL096PA2]
 gi|327448693|gb|EGE95347.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL043PA1]
 gi|327449114|gb|EGE95768.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL043PA2]
 gi|328762218|gb|EGF75714.1| leucyltransferase [Propionibacterium acnes HL099PA1]
          Length = 243

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 91/168 (54%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
              + Y  L   G+AH++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RAMEVYRYLHDRGWAHSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|170078062|ref|YP_001734700.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           PCC 7002]
 gi|169885731|gb|ACA99444.1| leucyl/phenylalanyl-tRNA--protein transferase [Synechococcus sp.
           PCC 7002]
          Length = 195

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 101/173 (58%), Gaps = 7/173 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD    Q + W    +R +IPL+  F  PK L++ + ++++  +IN AFE+V + CA  
Sbjct: 21  MADE--QQHLGWYSSRQRTLIPLDGRFRYPKSLRRSLNQQIFTPKINQAFEAVCAGCA-- 76

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R  TWI+  +   Y  L   G+AH+ E W+ D L GG+ G+++G  F GESMF  + 
Sbjct: 77  --NRDVTWISPELLDIYRALHRAGWAHSFETWRGDQLAGGILGIAIGGAFIGESMFFQIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           N SK+ +  LV+HL+++ F+L D Q    HL +FG+  I +  Y +LL  A++
Sbjct: 135 NGSKVAMVLLVEHLRRQGFILFDAQLQNPHLERFGSYVIDNQDYRRLLAQAVR 187


>gi|254524387|ref|ZP_05136442.1| leucyl/phenylalanyl-tRNA--protein transferase [Stenotrophomonas sp.
           SKA14]
 gi|219721978|gb|EED40503.1| leucyl/phenylalanyl-tRNA--protein transferase [Stenotrophomonas sp.
           SKA14]
          Length = 246

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 91/171 (53%), Gaps = 5/171 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + I W  P  R +   E  H   R ++ +R   +++  +TAF  V+ ACA     RP
Sbjct: 55  SEGEPILWWSPDPRMVFRTEGVHLSSRFRRQLRGSTWEVTADTAFSRVMQACA--AAPRP 112

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI+  + +AY  L  +G+AH+ E W +  LVGG+YGV++G++FFGESMFS     
Sbjct: 113 GQDGTWISPAMIEAYSQLHDLGFAHSFEVWDRQTLVGGIYGVAIGSMFFGESMFSGASGG 172

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           SKI L  L   L+   + L+D Q    HL + GA  +   ++   +  A++
Sbjct: 173 SKIALAALAATLRGWGWALIDAQVENPHLLRMGAEHLPRAEFLAHVRQAVR 223


>gi|317051046|ref|YP_004112162.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfurispirillum
           indicum S5]
 gi|316946130|gb|ADU65606.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfurispirillum
           indicum S5]
          Length = 245

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 97/162 (59%), Gaps = 1/162 (0%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINM 70
           W  P  R I+PL      +  +K++RR  ++IR +T F  +IS CA   +  +  TWI+ 
Sbjct: 63  WYSPDPRMILPLTELSISRSTRKFLRRSTWEIRFDTHFIQIISQCANTLRPGQKGTWISE 122

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLV 130
               AY  L  MGY H +  ++  +L+GGLYG+SLG VFFGESMFS  +NASK  +  LV
Sbjct: 123 DFIDAYSRLHDMGYGHCVGVYENGLLIGGLYGLSLGKVFFGESMFSQRDNASKTAMIALV 182

Query: 131 KHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           KHL+   F  +D Q  + HL+  GA E++  QY +LLE +L+
Sbjct: 183 KHLRAWGFDFVDCQIPSEHLKHLGAQEVSRRQYFRLLEQSLE 224


>gi|86131197|ref|ZP_01049796.1| leucyl, phenylalanyl-tRNA-protein transferase [Dokdonia donghaensis
           MED134]
 gi|85818608|gb|EAQ39768.1| leucyl, phenylalanyl-tRNA-protein transferase [Dokdonia donghaensis
           MED134]
          Length = 210

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 90/165 (54%), Gaps = 6/165 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            Q I W  P  R ++  +  H  K ++K +R   + +  N  F  VI AC + K   +  
Sbjct: 46  GQPILWWTPDPRMVVAPQDVHVSKSMRKLLRDNPFKVTYNQNFLEVILACKRIKRYGQQG 105

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSL--GAVFFGESMFSHMENASK 123
           TWI   + +AY+ L  +GYA ++E W +D LVGGLYG+ L    VF GESMF+ + NASK
Sbjct: 106 TWITNDVVEAYLRLHQLGYAISVEVWYEDKLVGGLYGIDLQDKGVFCGESMFATVSNASK 165

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI---THVQYAK 165
           +    L + L K  + L+D Q  T+HL   GA EI   T ++Y K
Sbjct: 166 VGFITLSRKLTKNGYKLIDCQMYTDHLASLGAAEIPRETFLEYLK 210


>gi|150026382|ref|YP_001297208.1| leucyl/phenylalanyl-tRNA--protein transferase [Flavobacterium
           psychrophilum JIP02/86]
 gi|166990808|sp|A6H233|LFTR_FLAPJ RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|149772923|emb|CAL44407.1| Leucyltransferase [Flavobacterium psychrophilum JIP02/86]
          Length = 211

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 85/163 (52%), Gaps = 1/163 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            + I W  P +R ++  +       ++  I + ++ +  N AF  VI  C   K + +  
Sbjct: 48  GEPIMWWSPRQRMVLFFDALVVSHSMRNVINKNIFKVTFNKAFREVIQNCQSVKREGQHG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   + ++Y  L  +G A ++E W+ D LVGGLYGV +  VF GESMFS + NASK+ 
Sbjct: 108 TWITNEMIESYCKLHELGKAISVEIWQNDTLVGGLYGVDMFPVFCGESMFSKVSNASKMA 167

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
              L  +LK   + LLD Q   +HL   G  EI   ++ K L+
Sbjct: 168 FISLADYLKTNHYNLLDCQIYNDHLNSLGCREIPRDEFLKFLK 210


>gi|163787167|ref|ZP_02181614.1| Leucyltransferase [Flavobacteriales bacterium ALC-1]
 gi|159877055|gb|EDP71112.1| Leucyltransferase [Flavobacteriales bacterium ALC-1]
          Length = 207

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 93/164 (56%), Gaps = 5/164 (3%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRP 64
           +++ I W  P  R ++  +     K +K+  ++ L+ I  N AF  VI  CA+ K + + 
Sbjct: 47  DTEPILWWSPDPRFVLFPKDLKVSKSMKQVFKKSLFKITENKAFRDVIENCAEAKREGQD 106

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSL-GAVFFGESMFSHMENASK 123
            TWI   + +AYI L  +GYA ++E W+ D LVGGLYG++L   VF GESMF+ + NASK
Sbjct: 107 GTWITDEMIEAYIKLHKLGYAKSVEVWQNDKLVGGLYGIALDNKVFCGESMFAKVSNASK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           +    LV++     + L+D Q  T HL   GA  I+  ++ K L
Sbjct: 167 VGFITLVQN---SNYKLIDCQLHTKHLESLGAKHISRAEFLKHL 207


>gi|120437367|ref|YP_863053.1| leucyl/phenylalanyl-tRNA--protein transferase [Gramella forsetii
           KT0803]
 gi|166990809|sp|A0M5U1|LFTR_GRAFK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|117579517|emb|CAL67986.1| leucyl/phenylalanyl-tRNA protein transferase [Gramella forsetii
           KT0803]
          Length = 212

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 86/164 (52%), Gaps = 3/164 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            Q + W  P  R ++  E     K ++ Y+ ++ + +  N  FE VI AC     + +  
Sbjct: 48  GQPVLWWSPDPRMVLFPENLKIAKSMRPYLNQDKFQVTFNQEFEKVIEACGNVNREGQDG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG--AVFFGESMFSHMENASK 123
           TWI   I++ Y+ L   G A + E W+  +LVGGLYG+ L    VF GESMFS   NASK
Sbjct: 108 TWITPEIKENYLKLHQEGIAVSTEVWEGSMLVGGLYGIYLKDKKVFCGESMFSKASNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                LV+ L+K    L+D Q  T+HL   GA EI  +++ K L
Sbjct: 168 FGFIKLVQKLEKEGVKLIDCQIYTSHLESLGAEEIDRIEFLKFL 211


>gi|15838047|ref|NP_298735.1| leucyl/phenylalanyl-tRNA--protein transferase [Xylella fastidiosa
           9a5c]
 gi|33301332|sp|Q9PDD3|LFTR_XYLFA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|9106464|gb|AAF84255.1|AE003974_10 protein transferase [Xylella fastidiosa 9a5c]
          Length = 243

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 82/150 (54%), Gaps = 1/150 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPT 65
            Q   W  P  R +   ++ H  +R ++ +R   + +R +T F +VI ACA   ++ +  
Sbjct: 56  GQPPLWWSPDPRTVFRSDSIHLSRRFRRNLRTSTWTVRADTMFAAVIDACASTPRRGQDG 115

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWI   +++AY+ L    YAH++E +   +LVGG+YGV+LG +FFGESMFS    ASKI 
Sbjct: 116 TWITANMREAYLTLHQHSYAHSVEVFDGTMLVGGIYGVALGRMFFGESMFSTRNGASKIA 175

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
           L  L   L      L+D Q    HL   GA
Sbjct: 176 LASLAHFLHTHSAPLIDAQVENQHLLNLGA 205


>gi|218674199|ref|ZP_03523868.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhizobium etli GR56]
          Length = 136

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%)

Query: 1   MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKT 60
           MA+SA+  +I W++P  RG++PL+ FH  K L K +RR  ++IR + AFESVI+ACA++T
Sbjct: 27  MAESADDPEIFWVEPELRGVLPLDRFHISKSLAKTVRRHPFEIRFDHAFESVIAACAEET 86

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEA 90
             RP+TWIN TI+  Y  LF MG+AHT+EA
Sbjct: 87  SGRPSTWINQTIRSLYSTLFDMGHAHTVEA 116


>gi|89073389|ref|ZP_01159913.1| hypothetical leucyl/phenylalanyl-tRNA-protein transferase
           [Photobacterium sp. SKA34]
 gi|89050876|gb|EAR56350.1| hypothetical leucyl/phenylalanyl-tRNA-protein transferase
           [Photobacterium sp. SKA34]
          Length = 237

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 76/151 (50%), Gaps = 1/151 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  + + W  P  RG+    TF   K LKK+ R+  Y + IN     VI  CA   +   
Sbjct: 53  SEGEPLLWWSPTPRGVFHPHTFMPSKSLKKFFRKSGYTVTINKGCHDVIRHCA-SCRGPE 111

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   +  AY  L  +G  H++E W    LVGG YG+ +G VF GESMFS  +NASKI
Sbjct: 112 QTWITEEMISAYQRLHTLGICHSVEVWSSGKLVGGFYGIEIGTVFCGESMFSLADNASKI 171

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
            L    ++  +    L+D Q +  HL   GA
Sbjct: 172 ALWQFCRYFSELGGTLIDCQMMNPHLESLGA 202


>gi|113867418|ref|YP_725907.1| leucyl/phenylalanyl-tRNA--protein transferase [Ralstonia eutropha
           H16]
 gi|123134148|sp|Q0KBT2|LFTR_RALEH RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|113526194|emb|CAJ92539.1| Leucyl/phenylalanyl-tRNA-protein transferase [Ralstonia eutropha
           H16]
          Length = 250

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 83/149 (55%), Gaps = 1/149 (0%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTI 88
           K L++ +R   ++IR++  F +V+ ACA   +  +  TWI   I  AY  L   G AH++
Sbjct: 81  KTLRRVLRDADWEIRVDDDFLAVMRACATTPRDGQDGTWITDDIIAAYGTLHRNGMAHSV 140

Query: 89  EAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITN 148
           E+W +   VGGLYGV+LG +FFGESMF+H  +ASKI L  L   L      ++D Q  T+
Sbjct: 141 ESWYRGERVGGLYGVALGRMFFGESMFAHRTDASKIALAALCAFLGNHGVAMIDCQQETD 200

Query: 149 HLRQFGAIEITHVQYAKLLENALKHPEIS 177
           HL   GA  I   ++   +  A   P IS
Sbjct: 201 HLASLGARPIPRAEFVAHVRAATALPAIS 229


>gi|327456164|gb|EGF02819.1| leucyl/phenylalanyl-tRNA--protein transferase [Propionibacterium
           acnes HL083PA2]
          Length = 243

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 92/168 (54%), Gaps = 11/168 (6%)

Query: 11  SWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINM 70
           +W  P+RRGI+        + L+K  +   +   ++ AF+ VI+ CA  T  RP  WI  
Sbjct: 57  AWWSPMRRGILLPGQLKVARSLRKTTKH--HTTSVDRAFDEVITRCADPT--RPYAWIGD 112

Query: 71  TIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHME---NASKICL 126
            + + Y  L   G+A+++E W  +  LVGGLYGVS+G  F GESMF   E   +ASK  L
Sbjct: 113 RVMEVYRYLHDRGWAYSVETWNAQGRLVGGLYGVSVGGFFSGESMFHDPEYGRDASKTAL 172

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             LV  L      LLD+Q+ T HL + G I++   +Y  LL +AL+ P
Sbjct: 173 MRLVCELGPG---LLDVQWSTPHLARLGVIDVDRAEYLALLSDALERP 217


>gi|126667261|ref|ZP_01738234.1| leucyl/phenylalanyl-tRNA--protein transferase [Marinobacter sp.
           ELB17]
 gi|126628206|gb|EAZ98830.1| leucyl/phenylalanyl-tRNA--protein transferase [Marinobacter sp.
           ELB17]
          Length = 238

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 90/171 (52%), Gaps = 3/171 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ Q I W  P  R +I  E  H  + L++ + +  + +  + AF  ++  C   + +  
Sbjct: 52  SDDQPILWWSPDPRCVIYPENIHISRSLRRSLNKGYFTVTADRAFSRIMRLCG--STRAE 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKK-DVLVGGLYGVSLGAVFFGESMFSHMENASK 123
            TWI   + +AY  L   G AH+IE W     L GG+YG++LG+ FFGESMFS   NASK
Sbjct: 110 GTWITENMLQAYNKLHREGIAHSIEIWNPHGELAGGMYGIALGSCFFGESMFSLETNASK 169

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           + + HL   L++  + ++D Q  ++HL   GA  I   ++  +L    K P
Sbjct: 170 VLMVHLANQLQQWGYQIIDCQVASDHLLSMGAQTIPRTEFLAMLGRYTKQP 220


>gi|152993641|ref|YP_001359362.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfurovum sp.
           NBC37-1]
 gi|151425502|dbj|BAF73005.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfurovum sp.
           NBC37-1]
          Length = 248

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 90/166 (54%), Gaps = 1/166 (0%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P  R ++    F   K  ++ +R   Y +  + AF  VI  CA    Q +  TWI
Sbjct: 63  ILWWSPDPRLLLYPGKFKVRKSFRRVLRSSRYTVTFDKAFSDVIRHCATVYRQGQDHTWI 122

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              +Q+AYI L   G+AH++E +++  LVGGLYG+++G  FFGESMFS   +ASK+    
Sbjct: 123 IPEMQEAYIRLHEEGFAHSVEVYREGELVGGLYGLAMGKAFFGESMFSLASDASKVAFKA 182

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           L   L  + +  +D Q  T+H+   GA  +   +Y   LE+AL+ P
Sbjct: 183 LSDVLGAKGYDFIDCQMKTDHMVGLGAEVVERNRYLDELESALEKP 228


>gi|329118873|ref|ZP_08247569.1| leucyltransferase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465064|gb|EGF11353.1| leucyltransferase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 272

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 83/169 (49%), Gaps = 6/169 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINM 70
           W     R ++  +  H  + L K +R   Y +  N  F  VI+ACA K +  +  TWI  
Sbjct: 83  WFAVSPRAVLLPQNLHVGRSLAKTLRNRAYRVTANRCFARVIAACAGKARPGQEGTWIAP 142

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY  L  +G+AH+ E W  D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 143 EFQTAYARLHALGHAHSFECWLPDAGGRLRLAGGFYGVQIGRVFYGESMFADAPDASKIA 202

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               V +L      L+D Q  T HLR+FG+  +    +   L +  + P
Sbjct: 203 FACAVPYLAGCGVALIDCQQDTEHLRRFGSHTVGFADFQTALRDLNEEP 251


>gi|325266666|ref|ZP_08133343.1| leucyltransferase [Kingella denitrificans ATCC 33394]
 gi|324982109|gb|EGC17744.1| leucyltransferase [Kingella denitrificans ATCC 33394]
          Length = 245

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 85/170 (50%), Gaps = 6/170 (3%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RP 64
           +  D  W     R +I     H  + L+K +R   Y + +N AFE VI+ CA   +K + 
Sbjct: 53  HEHDFYWFTQHPRAVIFPHKMHIGRSLQKILRHRAYRVTVNHAFEDVIAHCAAAPRKGQG 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKD-----VLVGGLYGVSLGAVFFGESMFSHME 119
            TWI      AY  L   G AH++E W  D      L GG YGV LG VF+GESMFS   
Sbjct: 113 GTWIGEDFIAAYTQLHRQGKAHSVECWYPDRAGCFQLAGGFYGVQLGQVFYGESMFSRQN 172

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
           NASKI     V +  +    L+D Q  T H+++FG+  +   ++ +LL  
Sbjct: 173 NASKIAFARAVPYFAQCGIQLIDCQQDTAHMQRFGSELLPLEEFVRLLNQ 222


>gi|150017425|ref|YP_001309679.1| leucyl/phenylalanyl-tRNA--protein transferase [Clostridium
           beijerinckii NCIMB 8052]
 gi|149903890|gb|ABR34723.1| Leucyltransferase [Clostridium beijerinckii NCIMB 8052]
          Length = 217

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 90/166 (54%), Gaps = 1/166 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            + I W  P  R I+  +     K +KK I+++++ +  N  F  VIS C   +      
Sbjct: 51  GEPILWWCPKPRFILIPDEVKISKSMKKIIKKDMFHVTFNKDFYGVISNCKDIREDNNEG 110

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           TWIN  ++KAY++LF  GYA ++E +  + LVGGLYGV +G  FFGESMFS + NASKI 
Sbjct: 111 TWINNDMKKAYMNLFNKGYAMSVETYLNNELVGGLYGVKIGKCFFGESMFSKVSNASKIA 170

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           L  L + LK   F+ +D Q  T HL   G   +    +  LL   +
Sbjct: 171 LIKLAEKLKNENFIFIDCQMHTKHLESMGGKFVEWPTFKDLLRKGI 216


>gi|282899038|ref|ZP_06307019.1| Leucyl/phenylalanyl-tRNA--protein transferase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281195954|gb|EFA70870.1| Leucyl/phenylalanyl-tRNA--protein transferase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 197

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 97/168 (57%), Gaps = 7/168 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD  N   + W +     +IPL E F  P+ L++ + ++ + ++IN  F  V+  CA  
Sbjct: 25  MADEYNQ--LRWYRSKEHTLIPLDERFRYPRSLQRALNQQRFTVKINQDFMGVVRGCA-- 80

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R TTWI+  +Q+ Y  L+  GYA++ E W+ + L GG+ G+ +G  F GESMF H+ 
Sbjct: 81  --NRETTWISPQLQQIYWLLYQAGYAYSFETWQGNQLAGGILGIVIGGAFIGESMFYHIP 138

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
             SK+ +  LV+ L++R+FL+ D Q +  HL +FGA  I   +Y  LL
Sbjct: 139 EGSKVAMVKLVERLRERKFLVFDAQIMNPHLARFGAYSIQVEEYNTLL 186


>gi|289670482|ref|ZP_06491557.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 249

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 93/173 (53%), Gaps = 5/173 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ Q I W  P  R +   +      R K+ +R   + IR +TAFE VI+ACA  +  RP
Sbjct: 55  SDGQPILWWSPDPRMVFRTDALRLSSRFKRQLRSSSWTIRADTAFEQVINACA--SVPRP 112

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AYI L  +G+AH+ E +    L+GG+YGV++G +FFGESMFS     
Sbjct: 113 GQDGTWITAPMQQAYIALHRLGHAHSFEVFDGTHLIGGIYGVAIGQMFFGESMFSVQTGG 172

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           SK+ L  L  +L+   + LLD Q    HL   GA  +    + + +E  +  P
Sbjct: 173 SKVALAALAAYLQAEGWPLLDAQVENPHLLSLGAQRLPRAPFLQQVELQVAQP 225


>gi|225025107|ref|ZP_03714299.1| hypothetical protein EIKCOROL_01999 [Eikenella corrodens ATCC
           23834]
 gi|224942068|gb|EEG23277.1| hypothetical protein EIKCOROL_01999 [Eikenella corrodens ATCC
           23834]
          Length = 249

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 84/156 (53%), Gaps = 10/156 (6%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP---TTWI 68
           W     R ++  +  H  + L K +R   Y + +N  F +VISACA     RP    +WI
Sbjct: 60  WFATAPRTVLQPQRLHIGRSLAKTMRNRHYAVTVNQNFPAVISACA--ATPRPHQGGSWI 117

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKD-----VLVGGLYGVSLGAVFFGESMFSHMENASK 123
               Q AY +L  +G+AH+ E W  D     +L GGLYGV +G VFFGESMF+   +ASK
Sbjct: 118 APAFQVAYNELHRIGHAHSFECWYPDENDHLLLAGGLYGVQIGRVFFGESMFAWQNDASK 177

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
           I   H V  L++    L+D Q  T HL +FG+  +T
Sbjct: 178 IAFAHAVPFLQRCGIALIDCQQDTPHLARFGSELMT 213


>gi|237749014|ref|ZP_04579494.1| leucyl/phenylalanyl-tRNA-protein transferase [Oxalobacter
           formigenes OXCC13]
 gi|229380376|gb|EEO30467.1| leucyl/phenylalanyl-tRNA-protein transferase [Oxalobacter
           formigenes OXCC13]
          Length = 247

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 95/181 (52%), Gaps = 8/181 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR--------ELYDIRINTAFESVISAC 56
           +  Q I W     R ++P + F   + LKK +++          + +  +TAF  VI  C
Sbjct: 52  SEGQPILWWSTDPRMVLPTDEFVVSRSLKKKLKQIHKSIHSDGHWKLTFDTAFIRVILEC 111

Query: 57  AQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFS 116
           A   +    TWI   I ++Y+ L  MG AH+ E W  + LVGG YG+ LG +F+GESMF+
Sbjct: 112 AGPRRNADGTWITEEIIRSYVALHKMGIAHSSELWFDNQLVGGAYGICLGKMFYGESMFA 171

Query: 117 HMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
            + +ASK+ L HLV  L++    L+D Q  T HL   GA  ++  ++ + L   +  P I
Sbjct: 172 RVSDASKVALAHLVFFLRQNGVELIDCQQETPHLASLGAHPVSRKRFNEHLSRVVDLPTI 231

Query: 177 S 177
           S
Sbjct: 232 S 232


>gi|166712086|ref|ZP_02243293.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 265

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 5/162 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ + I W  P  R +   +      R K+ +R   + +R +TAFE VI ACA     RP
Sbjct: 71  SDGRPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACA--ASPRP 128

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q+AYI L  +G+AH+IE +    LVGG+YG+++G +FFGESMFS     
Sbjct: 129 GQDGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGLAVGRMFFGESMFSGESGG 188

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           SK+ L  L   L  R + L+D Q    HL   GA  +    +
Sbjct: 189 SKVALAALAADLHGRGWPLIDAQVENPHLLSMGAERLPRADF 230


>gi|261856561|ref|YP_003263844.1| leucyl/phenylalanyl-tRNA/protein transferase [Halothiobacillus
           neapolitanus c2]
 gi|261837030|gb|ACX96797.1| leucyl/phenylalanyl-tRNA/protein transferase [Halothiobacillus
           neapolitanus c2]
          Length = 227

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 82/160 (51%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++    FH  + L K+ R++ Y I +N AF  V++ CA     +  TWI   
Sbjct: 62  WWSPDPRTVLTPTGFHLSRSLAKWRRQQRYRISVNEAFADVVAGCAAPRSDQDGTWIVPD 121

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           + K +I+L   G+ ++IE W    LVGGL+G   G   FGESMFS + NASK+ L  ++ 
Sbjct: 122 MFKLFIELHQAGHGYSIEIWDGTQLVGGLFGAKFGRAAFGESMFSRVPNASKLALAAILI 181

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
                +   LD QF T HL   GA E +   +   L  ++
Sbjct: 182 DQSWGEVDFLDCQFTTTHLLSLGAEEWSRSLFIHRLNRSM 221


>gi|237746865|ref|ZP_04577345.1| leucyl/phenylalanyl-tRNA-protein transferase [Oxalobacter
           formigenes HOxBLS]
 gi|229378216|gb|EEO28307.1| leucyl/phenylalanyl-tRNA-protein transferase [Oxalobacter
           formigenes HOxBLS]
          Length = 250

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 92/181 (50%), Gaps = 8/181 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR--------ELYDIRINTAFESVISAC 56
           + +Q + W     R ++P E F     LKK +R+          + ++ +  F  VI AC
Sbjct: 52  SENQPVLWWSTDPRMVLPTEHFVISHSLKKKLRQIHKSIHTGGPWKLKFDADFGQVIKAC 111

Query: 57  AQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFS 116
           A        TWI   I   Y  L  MG AH+ E W ++ LVGG YG+ LG +FFGESMF+
Sbjct: 112 AAPRNHIAGTWITDEIIDNYQKLHEMGIAHSSELWYENRLVGGAYGICLGKIFFGESMFA 171

Query: 117 HMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
            + +ASKI L+HLV  LK     ++D Q  T HL   GA  I+   +   L++ +  P +
Sbjct: 172 RVRDASKIALSHLVFFLKMNGVKMIDCQQETAHLASLGARPISRADFTVHLKSVIDLPPV 231

Query: 177 S 177
           +
Sbjct: 232 T 232


>gi|253996877|ref|YP_003048941.1| leucyl/phenylalanyl-tRNA--protein transferase [Methylotenera
           mobilis JLW8]
 gi|253983556|gb|ACT48414.1| leucyl/phenylalanyl-tRNA/protein transferase [Methylotenera mobilis
           JLW8]
          Length = 235

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 90/161 (55%), Gaps = 1/161 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KR 63
           +  + I W  P  R ++          L+K ++++ ++++++T F  VI+AC+   + ++
Sbjct: 60  SEGEPILWWSPSPRMVLYPHELKISNSLQKTLKKKTFEVKLSTQFREVITACSNTLRSQQ 119

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI   I  AY  L   G+A ++E++    LVGG YGV +G +F+GESMF H  +ASK
Sbjct: 120 AGTWITQDIIDAYCRLHDAGFAISVESYFDGQLVGGCYGVHIGNMFYGESMFHHKTDASK 179

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYA 164
           +    LV+HL  +   L+D Q  T HL   GA EI   ++A
Sbjct: 180 VAFVSLVQHLTAQGVGLIDCQMKTAHLASLGAREIERAEFA 220


>gi|213586625|ref|ZP_03368451.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
          Length = 157

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 77/143 (53%), Gaps = 2/143 (1%)

Query: 32  LKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAW 91
           +K++     Y + +N AF+ VI  CA    +   TWI   I++AY  L  +G+AH+IE W
Sbjct: 1   MKRFHNASPYRVTLNYAFDRVIDGCA--NHRDEGTWITRGIEEAYRRLHELGHAHSIEVW 58

Query: 92  KKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLR 151
           +   LVGG+YGVS GA+F GESMFS  ENASK  L        +    L+D Q + +H  
Sbjct: 59  RDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTA 118

Query: 152 QFGAIEITHVQYAKLLENALKHP 174
             GAIEI    Y   L    + P
Sbjct: 119 SLGAIEIPRRDYLDHLAALRQQP 141


>gi|149928518|ref|ZP_01916749.1| leucyl/phenylalanyl-tRNA--protein transferase [Limnobacter sp.
           MED105]
 gi|149822757|gb|EDM82013.1| leucyl/phenylalanyl-tRNA--protein transferase [Limnobacter sp.
           MED105]
          Length = 242

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 92/178 (51%), Gaps = 4/178 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKT 60
           ++ + + W     R ++    F   + L K IR+        I +NTAFE V+ ACA   
Sbjct: 53  SHGEPVLWWSTSPRAVLYTAEFKLHRSLAKAIRKMQATPGSAIHLNTAFEKVMRACAAPR 112

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMEN 120
             +  TWI   +  AY  L   G AH++E W+ D L+GGLY V+LG + +GESMF+   +
Sbjct: 113 PGQDGTWITEEVIAAYTALHQRGLAHSVEHWQGDQLIGGLYCVALGKMVYGESMFATQTD 172

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           ASK+   H V  LK +   ++D Q  T HL   GA  ++   +   + N++  P +++
Sbjct: 173 ASKVAFAHFVYWLKSQNVHIIDCQQATGHLMSMGARTVSRKVFETEMANSIVQPTLNW 230


>gi|319787142|ref|YP_004146617.1| leucyl/phenylalanyl-tRNA/protein transferase [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465654|gb|ADV27386.1| leucyl/phenylalanyl-tRNA/protein transferase [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 244

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 94/175 (53%), Gaps = 5/175 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R ++  +  H   R ++ +RR  +++R +TAFE VI+ACA  +  RP
Sbjct: 54  SEGQPILWWSPDPRMVLRTDAVHLSSRFRRELRRSRWEVRADTAFEEVIAACA--SIPRP 111

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q AY+ L  +G+AH++E +    LVGG+YGV++G +FFGESMFS     
Sbjct: 112 GQDGTWILPEMQAAYVGLHRLGHAHSVEVFDGTRLVGGIYGVAMGRMFFGESMFSGESGG 171

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           SK+ +  L + L    + LLD Q    HL   GA       +A+ +      P +
Sbjct: 172 SKVAIAALARQLHAWGWPLLDAQVENPHLVSLGAERWPRPAFARAVAELAAGPGL 226


>gi|149376388|ref|ZP_01894151.1| leucyl/phenylalanyl-tRNA--protein transferase [Marinobacter
           algicola DG893]
 gi|149359402|gb|EDM47863.1| leucyl/phenylalanyl-tRNA--protein transferase [Marinobacter
           algicola DG893]
          Length = 237

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 88/169 (52%), Gaps = 3/169 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           ++ Q I W  P  R ++  E  H  + L++ + R  + I  + AF  +I  CA    +  
Sbjct: 52  SDDQPILWWSPSPRCVLFPEEIHVSRSLRRTLNRGYFTITADQAFPRIIRLCANTRAE-- 109

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
            TWI   +  +Y  L   G AH+IE W  K  L GG+YG+++G  FFGESMFS   NASK
Sbjct: 110 GTWITQDMIDSYGQLHKQGIAHSIEVWNPKGELAGGMYGLAIGRCFFGESMFSLETNASK 169

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALK 172
           + + HL   L++  + ++D Q  + HL + GA  I   ++  +L   + 
Sbjct: 170 VLMVHLANQLREWGYRIMDCQVESGHLLRMGARSIPRSEFLSILRTCVD 218


>gi|329118195|ref|ZP_08246905.1| leucyltransferase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465616|gb|EGF11891.1| leucyltransferase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 198

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 78/150 (52%), Gaps = 6/150 (4%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R ++  E  H  + L K +R + Y +  N  F  VI+ACAQ  + K+  TWI  
Sbjct: 39  WFAQHSRAVLLPERLHIGRSLAKTLRHKSYRVSANARFADVIAACAQVPRPKQGGTWITP 98

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY  L  MG+AH+ E W  D      L GG YGV +G+VF+G SMF+H  +ASKI 
Sbjct: 99  DFQAAYTALHRMGHAHSFECWLPDAAVQWQLAGGFYGVQIGSVFYGASMFAHRADASKIA 158

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
               V  L      L+D Q  T HL +FG+
Sbjct: 159 FACAVPFLADCGIRLIDCQQDTAHLARFGS 188


>gi|126640924|ref|YP_001083908.1| leucyl/phenylalanyl-tRNA--protein transferase [Acinetobacter
           baumannii ATCC 17978]
          Length = 164

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 85/147 (57%), Gaps = 4/147 (2%)

Query: 32  LKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAW 91
           +KKY     Y I +N AFE VI +C+        TWI+  I + Y  +F  GY +++E W
Sbjct: 1   MKKYD----YTITVNRAFEQVIRSCSLPRSYANETWISEDIIEGYCGMFDAGYGYSVEVW 56

Query: 92  KKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLR 151
           +++ LVGGLYGV++G   FGESMFS   + SK+    L+   ++ Q   +D Q + +HL 
Sbjct: 57  QEEQLVGGLYGVTIGKGCFGESMFSTQTDVSKMAFYTLMLIGQENQLPWVDCQLVNSHLI 116

Query: 152 QFGAIEITHVQYAKLLENALKHPEISF 178
             GA  ++  +Y K L++ + HP I++
Sbjct: 117 SLGACTLSRQEYLKSLQDVIIHPSINW 143


>gi|42522551|ref|NP_967931.1| leucyl/phenylalanyl-tRNA--protein transferase [Bdellovibrio
           bacteriovorus HD100]
 gi|39575083|emb|CAE78924.1| leucyl/phenylalanyl-tRNA--protein transferase [Bdellovibrio
           bacteriovorus HD100]
          Length = 221

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 92/163 (56%), Gaps = 8/163 (4%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRR--ELYDIRINTAFESVISACAQKTQKRPT---T 66
           W  P  RG++    FH P+ L+++ +R  E++   +N  F  V+  C++  Q RP    T
Sbjct: 54  WFSPEERGVLEFRDFHVPESLRRFRKRHPEIH-FSVNQDFHHVLEECSK--QPRPGQDGT 110

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI   +++AY++ F  GY  ++E  + +VL+GG+YGV +  VF GESMF    NASK+ L
Sbjct: 111 WITAQMKRAYLEFFKAGYCMSVEVRENNVLIGGIYGVLVEGVFSGESMFYRKPNASKLAL 170

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
             LV+ L ++    +D+Q +T  +   G   I   QY ++LE 
Sbjct: 171 WRLVEVLSEQGHEWIDVQMVTPVVASMGGKLIDREQYLEMLEQ 213


>gi|325915384|ref|ZP_08177701.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538431|gb|EGD10110.1| leucyl/phenylalanyl-tRNA--protein transferase [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 249

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 88/162 (54%), Gaps = 5/162 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +  Q I W  P  R +   +      R ++ +R   + +R +TAF  VI+ACA  +  RP
Sbjct: 55  SEGQPILWWSPDPRMVFRTDRVRLSSRFRRQLRNCRWTLRADTAFAQVIAACA--SSPRP 112

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
               TWI   +Q AY+DL + G+AH++E +    LVGG+YGV++G +FFGESMFS +   
Sbjct: 113 GQDGTWITAQMQAAYVDLHHRGHAHSLEVFDGTRLVGGIYGVAVGRMFFGESMFSAVSGG 172

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           SK+ L  L   L  R + LLD Q    HL   GA  +   ++
Sbjct: 173 SKVALAALAAELHARGWPLLDAQVENPHLLSMGAQHMPRPEF 214


>gi|303327021|ref|ZP_07357463.1| leucyltransferase [Desulfovibrio sp. 3_1_syn3]
 gi|302863009|gb|EFL85941.1| leucyltransferase [Desulfovibrio sp. 3_1_syn3]
          Length = 264

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 90/162 (55%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++PLE F  P R  + +RR  +++ ++ AF  VI ACA        TW+ 
Sbjct: 57  ILWWSPDPRCVLPLEDFCLPSRSARALRRRPFELTLDAAFGEVIRACAGLRANGHGTWLT 116

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             +  AY  L  +GYAH++E+W+   LVGGLYGV+LG  FFGESMF     AS+  L  L
Sbjct: 117 PEMIAAYERLHALGYAHSVESWRDGALVGGLYGVALGRAFFGESMFHRESEASRAALAGL 176

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           V  L+ R  ++LD Q  T H+ + G + +    + + L  AL
Sbjct: 177 VALLRLRGAVVLDCQQETPHIMRMGGVMLPRAAFRERLARAL 218


>gi|289805268|ref|ZP_06535897.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 149

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 41  YDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGL 100
           Y + +N AF+ VI  CA    +   TWI   I++AY  L  +G+AH+IE W+   LVGG+
Sbjct: 2   YRVTLNYAFDRVIDGCA--NHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGM 59

Query: 101 YGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITH 160
           YGVS GA+F GESMFS  ENASK  L        +    L+D Q + +H    GAIEI  
Sbjct: 60  YGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPR 119

Query: 161 VQYAKLLENALKHP 174
             Y   L    + P
Sbjct: 120 RDYLDHLAALRQQP 133


>gi|269102230|ref|ZP_06154927.1| leucyl/phenylalanyl-tRNA--protein transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162128|gb|EEZ40624.1| leucyl/phenylalanyl-tRNA--protein transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 237

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 79/156 (50%), Gaps = 1/156 (0%)

Query: 8   QDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTW 67
           + I W  P  R      TF   K L+K+ R+  Y + IN A   VI  CA   +    TW
Sbjct: 56  EPILWWSPNPRAGFNPATFLPSKSLRKFQRKTNYTVTINQACHQVIEQCA-NCRGPEQTW 114

Query: 68  INMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLT 127
           I   +  AY  L  +GY H++E W  + LVGG YG+++G +F GESMFS  +NASKI L 
Sbjct: 115 ITPEMISAYQRLHDLGYCHSVEVWLNNQLVGGFYGIAIGTIFCGESMFSLADNASKIALW 174

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
              +H        +D Q +  HL   GA  +T  ++
Sbjct: 175 QFCRHFYASGGTSIDCQMMNPHLASLGAEIVTRNEF 210


>gi|257454481|ref|ZP_05619741.1| leucyl/phenylalanyl-tRNA--protein transferase [Enhydrobacter
           aerosaccus SK60]
 gi|257448139|gb|EEV23122.1| leucyl/phenylalanyl-tRNA--protein transferase [Enhydrobacter
           aerosaccus SK60]
          Length = 263

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/176 (34%), Positives = 85/176 (48%), Gaps = 4/176 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ----KTQK 62
            + I+W  P  R II    F   K LK+ I+   +   IN AF  VI+ACA         
Sbjct: 59  GEPIAWWSPDPRCIIYPSDFRASKTLKRRIKNAGWTFSINLAFAEVIAACADTRTYAQAS 118

Query: 63  RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
              TWI+  + +AY  L     A+++E W  D L+GGLYG+ LG  FFGESMF  + +AS
Sbjct: 119 ASATWISPAMIEAYTALHAEQVAYSVEIWDDDELIGGLYGLKLGQAFFGESMFHRVTDAS 178

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEISF 178
           K     L++     QF  +D Q    HL + GA  +   ++   L   L  P I +
Sbjct: 179 KAAFFVLMQLCAHSQFAWVDCQLPNPHLLRLGATILPRAEFLDKLAQQLSLPSIDW 234


>gi|171058661|ref|YP_001791010.1| leucyl/phenylalanyl-tRNA--protein transferase [Leptothrix cholodnii
           SP-6]
 gi|226737701|sp|B1Y1E6|LFTR_LEPCP RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|170776106|gb|ACB34245.1| Leucyltransferase [Leptothrix cholodnii SP-6]
          Length = 256

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 5/175 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELY----DIRINTAFESVISACAQKT 60
           +  Q + W     R ++ +  F   + LKK +RR L     ++RI++AF  VI  C++  
Sbjct: 55  SQGQPVLWWSTDPRMVLQVAQFRLHRSLKKTLRRFLVTPGNEVRIDSAFADVIDHCSRTP 114

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           ++ +  TWI   ++ AY+ L   G AH+ E W    LVGGLYGV++G +F+GESMF+   
Sbjct: 115 REGQDGTWIVPEVKAAYVALHRAGSAHSFETWVDGELVGGLYGVNIGRMFYGESMFARRT 174

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           +ASKI L  LV      +   +D Q  T HL   GA  +   Q+   L   +  P
Sbjct: 175 DASKIALAALVAFCLAHEIAWIDCQMETEHLASLGAQPVPRAQFEAHLRRVVDLP 229


>gi|89901126|ref|YP_523597.1| leucyl/phenylalanyl-tRNA--protein transferase [Rhodoferax
           ferrireducens T118]
 gi|119367717|sp|Q21VY7|LFTR_RHOFD RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|89345863|gb|ABD70066.1| Leucyltransferase [Rhodoferax ferrireducens T118]
          Length = 254

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 88/172 (51%), Gaps = 5/172 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKT 60
           +  Q   W  P  R ++ +  F      KK IR+       +IRI++AFE VI ACA   
Sbjct: 58  SEGQPTLWWSPNPRMVLQVANFRLRPSFKKKIRQFCQTPGCEIRIDSAFEQVIEACASSA 117

Query: 61  Q-KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI   ++ AY +L  +G AH++E W    L GGLY V+LG   FGESMFS + 
Sbjct: 118 RIGQSGTWIVPDMRAAYGELHRVGLAHSVETWVNGELAGGLYCVALGKAVFGESMFSRVS 177

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           +ASKI L  L+   +      +D Q  T HL   GA EI+   + K L   L
Sbjct: 178 DASKIALAALIGFCRHHGVKQIDCQQNTPHLASLGAGEISRDLFLKGLAAGL 229


>gi|301167466|emb|CBW27049.1| putative leucyl/phenylalanyl-tRNA--protein transferase
           [Bacteriovorax marinus SJ]
          Length = 225

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 97/177 (54%), Gaps = 9/177 (5%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           ++W  P  RG+I L+ FH  K  KK++ R    +  N  FESVI  CA  K + +  TWI
Sbjct: 48  LAWFAPDPRGVIDLKDFHVSKSFKKFLARTNMKVEFNQNFESVIMNCAMAKRKDQAGTWI 107

Query: 69  NMTIQKAYIDLFYMGYAHTIEAW--KKDV--LVGGLYGVSLGAVFFGESMFSHMENASKI 124
              I  +YI+L   GYA+++E +  K  V  +VGGLYG  +     GESM+   +NASK+
Sbjct: 108 TDQIIDSYINLHREGYAYSVETYLYKDGVKRMVGGLYGTCISNFISGESMYHIEDNASKL 167

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY----AKLLENALKHPEIS 177
            L  L++ LK +    LD Q +T  ++  G  EI+  ++    ++L  +AL  P+ +
Sbjct: 168 ALYTLIEFLKAKGIEWLDTQMVTPVIKSMGGKEISRSEFMQRISQLNMDALIKPDFN 224


>gi|91217391|ref|ZP_01254351.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychroflexus
           torquis ATCC 700755]
 gi|91184499|gb|EAS70882.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychroflexus
           torquis ATCC 700755]
          Length = 217

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 87/164 (53%), Gaps = 3/164 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            Q I W  P  R I+     +  K +KK    + + +  N  FE VI+ CA    +K+  
Sbjct: 48  GQPILWWSPDPRMILFPNKLNVSKSMKKLFNEKAFRVTYNENFEYVINKCANINREKQDG 107

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGA--VFFGESMFSHMENASK 123
           TWI   +  +YI L   G A +IE W+ D +VGGLYG+ L    VF GESMF+ ++NASK
Sbjct: 108 TWITDAMITSYIGLHKAGIAKSIEVWQDDKIVGGLYGLLLKDKNVFCGESMFTEVDNASK 167

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                LVK+++K    L+D Q  T HL   GA E++   +  LL
Sbjct: 168 YGFITLVKNMEKNGIRLIDCQVYTKHLESLGAEEVSRHNFLTLL 211


>gi|94310161|ref|YP_583371.1| leucyl/phenylalanyl-tRNA--protein transferase [Cupriavidus
           metallidurans CH34]
 gi|119367714|sp|Q1LP24|LFTR_RALME RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|93354013|gb|ABF08102.1| Leucyl/phenylalanyl-tRNA--protein transferase (L/F- transferase)
           (Leucyltransferase) (Phenyalanyltransferase)
           [Cupriavidus metallidurans CH34]
          Length = 249

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 80/135 (59%), Gaps = 1/135 (0%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTI 88
           K L++ +R   ++IR++  F +V+ ACA   +  +  TWI   I  AY  L  +G AH++
Sbjct: 81  KTLRRILRDPDWEIRVDDDFVAVMQACAMTPRDGQLGTWITDDIVAAYGSLHRLGLAHSV 140

Query: 89  EAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITN 148
           E W +   VGGLYGV+LG +F+GESMF+H  +ASKI L  L   L++    ++D Q  T+
Sbjct: 141 ETWYRGERVGGLYGVALGRMFYGESMFAHRTDASKIALAALCGFLERHGVTMIDCQQETD 200

Query: 149 HLRQFGAIEITHVQY 163
           HL   GA  I   Q+
Sbjct: 201 HLASLGAEPIPREQF 215


>gi|93005258|ref|YP_579695.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychrobacter
           cryohalolentis K5]
 gi|119367712|sp|Q1QDP2|LFTR_PSYCK RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|92392936|gb|ABE74211.1| Leucyltransferase [Psychrobacter cryohalolentis K5]
          Length = 274

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 92/176 (52%), Gaps = 13/176 (7%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACA-------- 57
           + + I+W  P  R ++    +   K L+K   R  + + +N AF+ VI AC+        
Sbjct: 66  DDEPIAWWCPEPRCVMQPTDYQPSKSLRKLANRSRWQLTLNQAFDEVIHACSLPRSNGVN 125

Query: 58  -QKTQKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGE 112
               + +P    TWI+  + +AY +L   G+AH+IE W  K  LVGGLYG+ +G ++FGE
Sbjct: 126 NDLNESQPVGEHTWIHDEMIEAYTELHAQGFAHSIEVWDDKGALVGGLYGLKIGGIYFGE 185

Query: 113 SMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           SMF    NASK+    L++  +     L+D Q   +HL   GAI ++  ++   L+
Sbjct: 186 SMFHIASNASKLAFWGLMRLCEHSNVNLVDCQLPNDHLMSLGAITLSRTEFLTQLD 241


>gi|297516804|ref|ZP_06935190.1| leucyl/phenylalanyl-tRNA--protein transferase [Escherichia coli
           OP50]
          Length = 182

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 74/122 (60%), Gaps = 2/122 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +    I W  P  R ++  E+ H  + +K++ +R  Y + +N AF  VI  CA   ++  
Sbjct: 51  SPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREE-- 108

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI   + +AY  L  +G+AH+IE W++D LVGG+YGV+ G +F GESMFS MENASK 
Sbjct: 109 GTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKT 168

Query: 125 CL 126
            L
Sbjct: 169 AL 170


>gi|316985125|gb|EFV64077.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis H44/76]
 gi|325199415|gb|ADY94870.1| leucyltransferase [Neisseria meningitidis H44/76]
          Length = 241

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 82/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G+VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDESGETRLAGGFYGVQIGSVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|89889898|ref|ZP_01201409.1| Leu/Phe-tRNA-protein transferase [Flavobacteria bacterium BBFL7]
 gi|89518171|gb|EAS20827.1| Leu/Phe-tRNA-protein transferase [Flavobacteria bacterium BBFL7]
          Length = 214

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 87/160 (54%), Gaps = 6/160 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLET---FHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KT 60
           ++   I W  P  R I  L +       K LK+ +R   Y ++ NT+F  V+  CA  K 
Sbjct: 46  SDGDPICWWSPDPRMIFDLSSDRPMRVTKSLKQSLRNRGYTVKENTSFTEVMQHCANVKR 105

Query: 61  QKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG--AVFFGESMFSHM 118
           +   +TWIN     +Y  L  +G+A ++E +K + LVGGLYG+ L    +F GESMF+  
Sbjct: 106 KDEDSTWINNDFINSYSKLHELGHAKSVEVFKDNQLVGGLYGIDLPNKKIFCGESMFTLA 165

Query: 119 ENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI 158
            +ASKI L HLV  LK + +  +D Q   +HL   GA+EI
Sbjct: 166 TDASKIALLHLVNTLKIKGYHFIDAQLYNDHLHSLGAVEI 205


>gi|225077519|ref|ZP_03720718.1| hypothetical protein NEIFLAOT_02582 [Neisseria flavescens
           NRL30031/H210]
 gi|224951139|gb|EEG32348.1| hypothetical protein NEIFLAOT_02582 [Neisseria flavescens
           NRL30031/H210]
          Length = 252

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 84/169 (49%), Gaps = 6/169 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H  + L K +R + Y + +N  FE VI+ CA   + ++  TWI  
Sbjct: 62  WYAVAPRAVIVPENLHIGRSLAKTLRHKPYRVTVNRCFEKVIAHCANVPRPEQDGTWIEP 121

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L + G+AH+ E W  D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 122 AFQTAYLKLHHQGHAHSFECWLPDEQGEMQLAGGFYGVQIGCVFYGESMFALRPDASKIA 181

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               V  L      L D Q  T H+R+FG+  +    +   L++    P
Sbjct: 182 FACAVPFLSDLGVALTDCQQDTEHMRRFGSQLMDFADFQTALKDLNAKP 230


>gi|332169994|gb|AEE19249.1| leucyl/phenylalanyl-tRNA/protein transferase [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 218

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 86/165 (52%), Gaps = 3/165 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
            Q I W  P  R ++     H  K ++K +R   + +  N  F  VI AC + K   +  
Sbjct: 54  GQPILWWTPDPRMVVKPSDVHVSKSMRKVLRDNHFTVTYNQNFLEVILACKRIKRNGQDG 113

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG--AVFFGESMFSHMENASK 123
           TWI   I  AY+ L  +G+A ++E W    LVGGLYG+ L    +F GESMF+ M NASK
Sbjct: 114 TWITNDIIDAYLRLHELGHAISVEVWHDKKLVGGLYGIDLKEKGIFCGESMFATMSNASK 173

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           +    L + L+K  + L+D Q  T+HL   GA EI    + + L+
Sbjct: 174 VGFITLSRRLEKENYHLIDCQMYTDHLASLGAAEIPRDLFLEYLQ 218


>gi|166367199|ref|YP_001659472.1| leucyl/phenylalanyl-tRNA--protein transferase [Microcystis
           aeruginosa NIES-843]
 gi|166089572|dbj|BAG04280.1| Leu/Phe-tRNA-protein transferase [Microcystis aeruginosa NIES-843]
          Length = 193

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 94/172 (54%), Gaps = 7/172 (4%)

Query: 1   MADSANSQDISWIKPLRRGIIPLET-FHTPKRLKKYIRRELYDIRINTAFESVISACAQK 59
           MAD     D  W     R +IPL+  F  PK LK+ + +  + + IN  F  V + CA  
Sbjct: 21  MADEGGRLD--WYSSKNRALIPLDRRFRYPKSLKRVLNQNRFSVAINRDFAGVCAGCA-- 76

Query: 60  TQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
              R  TWI+  + + Y  L   G+A++ E W+ D L GG+ G+++G VF GESMF  + 
Sbjct: 77  --DRSLTWISPELMQIYQQLHQAGWAYSFETWQGDQLAGGILGLAIGGVFIGESMFYKIP 134

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
           + SK+ +  LV+HL++R F L D Q    HL +FGA  I   +Y   LE+AL
Sbjct: 135 DGSKVAMVKLVEHLRERNFCLFDAQMQNPHLARFGAYTIPEQEYHARLESAL 186


>gi|238027534|ref|YP_002911765.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia glumae
           BGR1]
 gi|237876728|gb|ACR29061.1| Leucyl/phenylalanyl-tRNA--protein transferase [Burkholderia glumae
           BGR1]
          Length = 247

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 93/181 (51%), Gaps = 9/181 (4%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYD----IRINTAFESVISACAQKT 60
           ++ Q + W  P  R I+    F      +K +RR + D    +R++  F +V+ ACAQ  
Sbjct: 52  SDGQPVLWWSPDPRMILVPAEFRVSTTFRKTLRRVMRDARWEVRVDADFAAVMRACAQA- 110

Query: 61  QKRPT---TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             RP    TWI   I  AY  L   G AH++E W     VGGLYGV+ G +FFGESMF+H
Sbjct: 111 -PRPGQRGTWITDEIVAAYTALHRAGNAHSVETWFDGKRVGGLYGVAFGRMFFGESMFAH 169

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
             +ASKI L  LV HL +    ++D Q  T+HL   G  EI   ++   +  A   P I 
Sbjct: 170 ATDASKIALAALVAHLLEHGVEMIDCQQNTSHLASLGGREIDRRRFVAHVRAATGEPGIP 229

Query: 178 F 178
           +
Sbjct: 230 W 230


>gi|325954762|ref|YP_004238422.1| leucyl/phenylalanyl-tRNA--protein transferase [Weeksella virosa DSM
           16922]
 gi|323437380|gb|ADX67844.1| Leucyl/phenylalanyl-tRNA--protein transferase [Weeksella virosa DSM
           16922]
          Length = 211

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 89/163 (54%), Gaps = 6/163 (3%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           N +D I W  P  R ++        K ++K  R + +    N AFE VI  CA+  +K +
Sbjct: 47  NQEDPILWWFPPERFVLFPANLKVSKTMRKVFRNQQFHFTENLAFEQVIRLCAEIPRKNQ 106

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TW+   + +AY++L  +G+A +IE W++D LVGG YG+ +G VF GESMFS + NASK
Sbjct: 107 DGTWLTEEMIEAYVELHRLGWAKSIEVWEEDTLVGGFYGIEVGRVFCGESMFSKVSNASK 166

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEI---THVQY 163
               H +      ++ L+D Q  T HL   GA  I   T +QY
Sbjct: 167 AGFIHFIA-TNFHEYDLIDCQVYTEHLESLGAEMISAETFLQY 208


>gi|284007604|emb|CBA73204.1| leucyl/phenylalanyl-tRNA-protein transferase [Arsenophonus
           nasoniae]
          Length = 238

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 80/156 (51%), Gaps = 3/156 (1%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMT 71
           W  P  R ++     H  +  KK +R+  Y I +N  FE VI+ CAQ+ +    TWI   
Sbjct: 56  WWSPDPRAVLLPAEIHISRTTKKRMRKTPYVITLNHDFEQVIAGCAQRQEG---TWITHQ 112

Query: 72  IQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVK 131
           I ++Y  L  +G AH++E W    L+GGLYGV++G +F GESMFS + + SK  L     
Sbjct: 113 IIESYTALHQLGVAHSVEVWHNTKLIGGLYGVNVGKIFCGESMFSRVSDGSKYALIAFYH 172

Query: 132 HLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           H  +    L D Q I  +    G  EI  +Q+   L
Sbjct: 173 HFLRFGGKLFDCQIINAYTASLGVREIPRIQFLNYL 208


>gi|332107754|gb|EGJ08978.1| leucyl/phenylalanyl-tRNA--protein transferase [Rubrivivax
           benzoatilyticus JA2]
          Length = 245

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 93/176 (52%), Gaps = 5/176 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKTQK 62
            Q + W  P  R ++P   F     L+K +RR      ++IR++ AF+ VI+ACA   + 
Sbjct: 56  GQPVLWWSPDPRMVLPTAEFRVSHSLRKTLRRFARTPGHEIRVDHAFDRVIAACAGTPRD 115

Query: 63  -RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +  TWI   +  AY +   +G AH+ E W    LVGGLYGV +G +FFGESMF+H  +A
Sbjct: 116 GQDGTWIVPQVMNAYREWHRLGRAHSFETWIDGELVGGLYGVGIGRMFFGESMFAHRTDA 175

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEIS 177
           SK+ L  LV   +     L+D Q  T HL   GA EI    + + L NA    +I 
Sbjct: 176 SKLALAALVAFARANGITLIDCQQNTRHLASLGAHEIDREAFERHLANACAQEDIG 231


>gi|120611764|ref|YP_971442.1| leucyl/phenylalanyl-tRNA--protein transferase [Acidovorax citrulli
           AAC00-1]
 gi|120590228|gb|ABM33668.1| Leucyltransferase [Acidovorax citrulli AAC00-1]
          Length = 253

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 92/169 (54%), Gaps = 5/169 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKTQK 62
            Q I W  P  R ++ +E+F   + L++ ++R       +IR++ +F  VI ACAQ  + 
Sbjct: 59  GQPILWWSPDPRMVLAVESFRLHRSLRRTLQRFRTSPGCEIRVDHSFPDVIRACAQTPRG 118

Query: 63  -RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENA 121
            +  TWI   +  AY +    G+AH+IE W+   LVGGLY + +G   FGESMF+H  +A
Sbjct: 119 GQHGTWIVPDMIAAYEEFHRAGHAHSIETWQDGRLVGGLYCIGIGRAVFGESMFAHATDA 178

Query: 122 SKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
           SKI L  LV   ++     +D Q  T HL   GA EI   ++ + ++ A
Sbjct: 179 SKIALAALVCLCRRHGAEWIDCQQNTAHLASLGAREIPRERFLRNVQAA 227


>gi|325203325|gb|ADY98778.1| leucyltransferase [Neisseria meningitidis M01-240355]
          Length = 241

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|261400956|ref|ZP_05987081.1| leucyltransferase [Neisseria lactamica ATCC 23970]
 gi|269209201|gb|EEZ75656.1| leucyltransferase [Neisseria lactamica ATCC 23970]
 gi|309379087|emb|CBX22218.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 241

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAVRPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQSDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|295136268|ref|YP_003586944.1| leucyl/phenylalanyl-tRNA--protein transferase [Zunongwangia
           profunda SM-A87]
 gi|294984283|gb|ADF54748.1| leucyl/phenylalanyl-tRNA--protein transferase [Zunongwangia
           profunda SM-A87]
          Length = 212

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 91/164 (55%), Gaps = 3/164 (1%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPT 65
           SQ I W  P  R ++        K +K+  +++ + I  N AFE+VI  CA+ K + +  
Sbjct: 49  SQPILWWCPDPRMVLFPHKLKVSKSMKQLFKKKAFKITYNEAFETVIENCAKIKRKGQLG 108

Query: 66  TWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG--AVFFGESMFSHMENASK 123
           TWI   ++ AYI L   G A ++E WK   +VGGLYG+ L    +F GESMF+ + NASK
Sbjct: 109 TWITPEMKAAYIGLNKKGIAQSVEVWKDGEIVGGLYGIYLKNKKLFCGESMFAKVSNASK 168

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
                +V+ L++    L+D Q  T+HL   GA EI+  ++ + L
Sbjct: 169 YGFISMVRKLQENGVKLIDCQVHTDHLESLGAEEISRKEFLEYL 212


>gi|158338199|ref|YP_001519376.1| leucyl/phenylalanyl-tRNA--protein transferase [Acaryochloris marina
           MBIC11017]
 gi|158308440|gb|ABW30057.1| leucyl/phenylalanyl-tRNA--protein transferase [Acaryochloris marina
           MBIC11017]
          Length = 194

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 88/159 (55%), Gaps = 5/159 (3%)

Query: 6   NSQDISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           N   + W     R I+PL E F  PK L++ + +  +   IN  F  V+  CA     R 
Sbjct: 22  NGDGLGWYSSQTRTIMPLDERFRYPKSLRRSLNQNRFTSAINRDFFGVVEGCA----NRD 77

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
           +TWI+  ++  Y+ L+  G+A + E W+ D L GG+ G+ +G VF GESMF H+   SK 
Sbjct: 78  STWISDELKMIYLLLYKAGWAFSFETWQDDQLAGGILGLVIGGVFIGESMFFHISEGSKA 137

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
            +  LV HL+ +QF L D+Q I  HL +FGA  I+  +Y
Sbjct: 138 AMVMLVDHLRSQQFTLFDVQIINPHLERFGAYTISEQEY 176


>gi|121634079|ref|YP_974324.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis FAM18]
 gi|158513133|sp|A1KRN6|LFTR_NEIMF RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|120865785|emb|CAM09514.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis FAM18]
 gi|325133128|gb|EGC55800.1| leucyltransferase [Neisseria meningitidis M6190]
 gi|325139096|gb|EGC61642.1| leucyltransferase [Neisseria meningitidis ES14902]
 gi|325141217|gb|EGC63717.1| leucyltransferase [Neisseria meningitidis CU385]
 gi|325197491|gb|ADY92947.1| leucyltransferase [Neisseria meningitidis G2136]
 gi|325202962|gb|ADY98416.1| leucyltransferase [Neisseria meningitidis M01-240149]
 gi|325207240|gb|ADZ02692.1| leucyltransferase [Neisseria meningitidis NZ-05/33]
          Length = 241

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 82/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L+K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLEKTLRNCSYRVTVNGCFAEVVAHCAAAVRPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLASLGVELIDCQQDTGHMRRFGSELLPFADFAERL 219


>gi|297568181|ref|YP_003689525.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924096|gb|ADH84906.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 236

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 1/152 (0%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
              + I W  P  R ++    FH  +RL + +R+  +    N  F  VI  CA+  +  +
Sbjct: 53  GPGEPILWWAPDPRLVLLPGEFHISRRLARKLRQGRFSFSTNQDFAGVIRHCAEIARPGQ 112

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             +W++  +  AY+ L  +GYAH++E  +   LVGG+YGV+LG VFFGESMFS   +ASK
Sbjct: 113 EGSWLSEEMIAAYLRLHELGYAHSVECRRDGRLVGGVYGVALGRVFFGESMFSLETDASK 172

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGA 155
             + HLV  ++     ++D Q  ++HL + GA
Sbjct: 173 AAMAHLVAAMETTGGTMIDCQVKSDHLLRLGA 204


>gi|213417381|ref|ZP_03350523.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 175

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L   
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLGF 173

Query: 130 VK 131
           ++
Sbjct: 174 LR 175


>gi|261381256|ref|ZP_05985829.1| leucyltransferase [Neisseria subflava NJ9703]
 gi|284795888|gb|EFC51235.1| leucyltransferase [Neisseria subflava NJ9703]
          Length = 252

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 6/169 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E     + L K +R + Y + +N  FE VI+ CA   + ++  TWI  
Sbjct: 62  WYAVAPRAVIVPENLRIGRSLAKTLRHKPYRVTVNRCFEKVIAHCANVPRPEQDGTWIEP 121

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L + G+AH+ E W  D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 122 AFQTAYLKLHHQGHAHSFECWLPDEQGEMQLAGGFYGVQIGCVFYGESMFALRPDASKIA 181

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               V  L+     L+D Q  T H+R+FG+  +    +   L++    P
Sbjct: 182 FACAVPFLEDLGVALIDCQQDTEHMRRFGSQLMDFADFQTALKDLNAKP 230


>gi|256819401|ref|YP_003140680.1| leucyl/phenylalanyl-tRNA/protein transferase [Capnocytophaga
           ochracea DSM 7271]
 gi|256580984|gb|ACU92119.1| leucyl/phenylalanyl-tRNA/protein transferase [Capnocytophaga
           ochracea DSM 7271]
          Length = 222

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 91/172 (52%), Gaps = 5/172 (2%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RP 64
             + + W  P  R ++  E  H  K ++K +R   Y +  N  F  V+  CA   +K + 
Sbjct: 48  EGEPVVWWCPDPRFVLFREKLHISKHMRKMLREAPYRVTYNHCFTEVMRQCATVPRKDQD 107

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
            TWI+  + +AY  L   G AH++E W+ DVL+GGLYG+ +G +F GESMFS   NAS+ 
Sbjct: 108 GTWIHPELIEAYTGLHKRGIAHSVEVWEGDVLIGGLYGLKMGKIFCGESMFSKRNNASEY 167

Query: 125 C-LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
             +T+L  H       L+D Q  + +L + GA EI   ++  LL  A +  E
Sbjct: 168 GFITYLQAH---PDIALVDCQIYSEYLERLGAEEIPRKEFLALLGKAYEERE 216


>gi|241759176|ref|ZP_04757284.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria flavescens
           SK114]
 gi|241320595|gb|EER56872.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria flavescens
           SK114]
          Length = 248

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 84/169 (49%), Gaps = 6/169 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E     + L K +R + Y + +N  FE VI+ CA   + ++  TWI  
Sbjct: 58  WYAVAPRAVIVPENLRIGRSLAKTLRHKPYRVTVNRCFEKVIAHCANVPRPEQDGTWIEP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKD-----VLVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L + G+AH+ E W  D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 AFQTAYLKLHHQGHAHSFECWLPDEQGEMQLAGGFYGVQIGCVFYGESMFALRPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
               V  L      L+D Q  T H+R+FG+  +    +   L++    P
Sbjct: 178 FACAVPFLSDLGVALIDCQQDTEHMRRFGSQLMDFADFQTALKDLNAKP 226


>gi|260221039|emb|CBA29206.1| Leucyl/phenylalanyl-tRNA--protein transferase [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 209

 Score =  104 bits (259), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 84/150 (56%), Gaps = 1/150 (0%)

Query: 30  KRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINMTIQKAYIDLFYMGYAHTI 88
           K +KK+      +IR++  F  VI AC+   +  +  TWI   I+ AY++L   G+AH++
Sbjct: 42  KVIKKFRNTPGAEIRVDHDFGGVIDACSGSERAGQSGTWIVPEIKAAYLELHKRGHAHSV 101

Query: 89  EAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITN 148
           E W+  VL+GGLY VS+G   FGESMF+   +ASKI LT LV     +    +D Q +T+
Sbjct: 102 ETWQDGVLMGGLYCVSIGRAVFGESMFARQTDASKIALTALVSMSMAQGVDWIDCQQVTD 161

Query: 149 HLRQFGAIEITHVQYAKLLENALKHPEISF 178
           HL   GA  +    ++  L +A   P I +
Sbjct: 162 HLAFMGARPVDRSIFSNYLSDATAQPGIEW 191


>gi|145588928|ref|YP_001155525.1| leucyl/phenylalanyl-tRNA--protein transferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047334|gb|ABP33961.1| Leucyltransferase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 245

 Score =  104 bits (259), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 92/177 (51%), Gaps = 5/177 (2%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIR----INTAFESVISACAQKT 60
           +++Q + W  P  R ++    F     L+K IR    D +    ++  F +VI ACA  +
Sbjct: 54  SDNQPVLWWSPDPRMVLKPSEFKCSISLQKNIRHFCQDDKSKLLVDNDFGAVIRACATSS 113

Query: 61  QK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +K +  TWI   I  AY  LF  G AH+I   +   L+GGLY V+LG++ FGESMFS   
Sbjct: 114 RKEQDGTWITHEIMDAYTSLFEQGRAHSIALIENGQLIGGLYCVALGSMVFGESMFSLKP 173

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPEI 176
           NASKI L+ L     +    ++D Q  TNHLR  G   I   ++ + L+ ++    I
Sbjct: 174 NASKIALSALSAWCIQNAIAMIDCQQETNHLRSLGGAPIPRPEFLEHLQKSVNQSTI 230


>gi|213428598|ref|ZP_03361348.1| leucyl/phenylalanyl-tRNA--protein transferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 175

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 70/117 (59%), Gaps = 2/117 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++  E FH  + +K++     Y + +N AF+ VI  CA    +   TWI 
Sbjct: 56  ILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDE--GTWIT 113

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
             I++AY  L  +G+AH+IE W+   LVGG+YGVS GA+F GESMFS  ENASK  L
Sbjct: 114 RGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTAL 170


>gi|332044675|gb|EGI80869.1| leucyl/phenylalanyl-tRNA/protein transferase [Lacinutrix algicola
           5H-3-7-4]
          Length = 214

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 88/161 (54%), Gaps = 5/161 (3%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P  R ++  E     K +++++R   +++ IN  F++VI+ CA+ K   +  TWI
Sbjct: 51  ILWWSPDPRFVLYPEDLKVSKSMRQFLRNCNFEVTINKDFKAVITNCAKVKRVGQSGTWI 110

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSL-GAVFFGESMFSHMENASKICLT 127
             ++  AY  L  +GYA ++E W  + LVGG YGV L   VF GESMF++  NASK    
Sbjct: 111 TNSMINAYCKLHKLGYAKSVEVWDNNELVGGFYGVDLNNGVFCGESMFANKSNASK---A 167

Query: 128 HLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
             +  ++   + L+D Q  T HL + GA EI+  ++   L 
Sbjct: 168 AFITFIQNTNYSLIDCQVYTAHLERLGAKEISRTKFLSYLN 208


>gi|222824063|ref|YP_002575637.1| leucyl/phenylalanyl-tRNA--protein transferase [Campylobacter lari
           RM2100]
 gi|254809115|sp|B9KCU7|LFTR_CAMLR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|222539285|gb|ACM64386.1| leucyl/phenylalanyl-tRNA--protein transferase [Campylobacter lari
           RM2100]
          Length = 213

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 89/162 (54%), Gaps = 7/162 (4%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           S  ++W  P  R ++  +  H  K +KK ++   Y+IR++  F  +I  C+     R  T
Sbjct: 43  SNPVTWWCPSPRMVLFPDEIHIQKSIKKALKT--YEIRLDYDFALLIKHCSL----RKKT 96

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WIN    + Y  LF    AH++E ++ D  +GGLYG+ +G VFFGESM S  ++ASKI L
Sbjct: 97  WINQEFIETYTKLFEQNLAHSVEVYENDEFIGGLYGLIIGKVFFGESMISLKKDASKIAL 156

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
             L + LK   F L+D Q    HL+  GA E+    + K+LE
Sbjct: 157 IKLCEILKPYDF-LIDCQVPNEHLKFMGAKEMIKKDFLKILE 197


>gi|254458869|ref|ZP_05072293.1| leucyl/phenylalanyl-tRNA--protein transferase [Campylobacterales
           bacterium GD 1]
 gi|207084635|gb|EDZ61923.1| leucyl/phenylalanyl-tRNA--protein transferase [Campylobacterales
           bacterium GD 1]
          Length = 228

 Score =  103 bits (258), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 88/156 (56%), Gaps = 3/156 (1%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKR 63
           ++   I W  P  R I+ L+ F            + ++ + +T FE V+  C+      +
Sbjct: 48  SSGDPIIWWSPDPRLIMELDDFKI--SKSLKKSMKKFEYKFDTNFEEVMHKCSTVNRNDQ 105

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  I +A+  +  MG AH+IE+++   LVGGLYG+ +G VF GESMF++M +ASK
Sbjct: 106 AGTWISSEIIEAFTTIHGMGMAHSIESYQNGELVGGLYGIVVGKVFCGESMFANMSDASK 165

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
                L+KHLK+  +  +D Q  TNHL+  GA E++
Sbjct: 166 SAYAVLIKHLKEWGYDFIDCQVPTNHLKSLGAKEVS 201


>gi|57237991|ref|YP_179240.1| leucyl/phenylalanyl-tRNA--protein transferase [Campylobacter jejuni
           RM1221]
 gi|81557471|sp|Q5HTZ5|LFTR_CAMJR RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|57166795|gb|AAW35574.1| leucyl/phenylalanyl-tRNA--protein transferase [Campylobacter jejuni
           RM1221]
 gi|315058550|gb|ADT72879.1| Leucyl/phenylalanyl-tRNA--protein transferase [Campylobacter jejuni
           subsp. jejuni S3]
          Length = 215

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           S+ ++W  P  R I+     H  K +KK+I   LY I+++  F  +I+ C      R  +
Sbjct: 43  SKPVTWWCPDPRCILIPNQIHIQKNMKKFIN--LYQIKLDYDFLKLITLCRDT---RSQS 97

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WIN      Y  LF  GYAH++E ++ + L+GG+YG+ LG VFFGESM S  +NASK+ +
Sbjct: 98  WINDEFITTYYKLFTQGYAHSLELYENNELIGGIYGLILGKVFFGESMVSIKKNASKVAM 157

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
             L   LK   F ++D Q    HL   GA  I+  ++  +L+
Sbjct: 158 IKLCDLLKPYDF-IIDCQVYNQHLEFMGAHNISRKEFLNILK 198


>gi|325135129|gb|EGC57756.1| leucyltransferase [Neisseria meningitidis M13399]
 gi|325137036|gb|EGC59632.1| leucyltransferase [Neisseria meningitidis M0579]
          Length = 241

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 80/162 (49%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P  L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPCSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|261378105|ref|ZP_05982678.1| leucyltransferase [Neisseria cinerea ATCC 14685]
 gi|269145558|gb|EEZ71976.1| leucyltransferase [Neisseria cinerea ATCC 14685]
          Length = 242

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 81/164 (49%), Gaps = 6/164 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINM 70
           W     R ++  +  H P+ L K +R   Y +  N  FE V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVVFPDRLHIPRSLAKTLRNRAYRVTANDCFERVVAQCADMVRPGQDGTWIVP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLQLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
               V  L      L+D Q  T H+R+FG+  +    +A  L +
Sbjct: 178 FACAVPFLASLGVELIDCQQDTEHMRRFGSELLPFADFAARLRS 221


>gi|71280540|ref|YP_269475.1| leucyl/phenylalanyl-tRNA--protein transferase [Colwellia
           psychrerythraea 34H]
 gi|119367693|sp|Q480P4|LFTR_COLP3 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|71146280|gb|AAZ26753.1| leucyl/phenylalanyl-tRNA--protein transferase [Colwellia
           psychrerythraea 34H]
          Length = 241

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 78/160 (48%), Gaps = 5/160 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP 64
           +++  + W  P  R II ++     + L+K I +  Y I +N  F  V   CA    +  
Sbjct: 53  SDNDPLMWWSPNPRAIIDIDQLRINRTLRKAINKSPYQITLNQDFSQVTQLCANAPFRTD 112

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKD-----VLVGGLYGVSLGAVFFGESMFSHME 119
            TWI   ++ AY+ L   GYAH+IE W  D      LVGGLYGV++   F GESMF    
Sbjct: 113 GTWILPEMEAAYLTLHQQGYAHSIEVWYTDEHDNKALVGGLYGVAVNGFFSGESMFYKQS 172

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
           NASK  L  L + LK      +D Q +   L   GA E +
Sbjct: 173 NASKFALIALGQLLKSVDINFIDCQLLNPFLEDMGAKETS 212


>gi|315224839|ref|ZP_07866660.1| leucyltransferase [Capnocytophaga ochracea F0287]
 gi|314945242|gb|EFS97270.1| leucyltransferase [Capnocytophaga ochracea F0287]
          Length = 222

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 92/173 (53%), Gaps = 6/173 (3%)

Query: 6   NSQD-ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-R 63
           N  D + W  P  R ++  E  H  K ++K +R   Y +  N  F  V+  CA   +K +
Sbjct: 47  NEGDPVVWWCPNPRFVLFREKLHISKHMRKMLREAPYCVTYNRCFTEVMRQCATVPRKDQ 106

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
             TWI+  + +AY  L   G AH++E W+ DVL+GGLYG+ +G +F GESMFS   NAS+
Sbjct: 107 DGTWIHPELIEAYTGLHKRGVAHSVEVWEGDVLIGGLYGLKMGKIFCGESMFSKRNNASE 166

Query: 124 IC-LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHPE 175
              +T+L  H       L+D Q  + +L + GA EI   ++  LL  A +  E
Sbjct: 167 YGFITYLQAH---PDIALVDCQIYSEYLERLGAEEIPRKEFLVLLGKAYEERE 216


>gi|218767104|ref|YP_002341616.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis Z2491]
 gi|33301328|sp|Q9JX50|LFTR_NEIMA RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|121051112|emb|CAM07383.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis Z2491]
          Length = 241

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 80/162 (49%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P  L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPCSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|326316986|ref|YP_004234658.1| leucyl/phenylalanyl-tRNA/protein transferase [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323373822|gb|ADX46091.1| leucyl/phenylalanyl-tRNA/protein transferase [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 253

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 91/173 (52%), Gaps = 13/173 (7%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRREL--------YDIRINTAFESVISACAQ 58
            Q I W  P  R ++ +E+F    RL + +RR L         +IR++ +F  VI ACAQ
Sbjct: 59  GQPILWWSPDPRMVLHVESF----RLHRSLRRTLQRFRTTPGCEIRVDHSFPDVIRACAQ 114

Query: 59  KTQK-RPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSH 117
             +  +  TWI   +  AY +    G+AH+IE W+   L GGLY + +G   FGESMF+H
Sbjct: 115 TPRGGQHGTWIVPDMIAAYEEFHRAGHAHSIETWQDGRLAGGLYCIGIGRAVFGESMFAH 174

Query: 118 MENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENA 170
             +ASKI L  LV   ++     +D Q  T HL   GA EI   ++ + ++ A
Sbjct: 175 ATDASKIALAALVCLCRRHGAEWIDCQQNTAHLASLGAREIPRERFLRNVQAA 227


>gi|319411310|emb|CBY91721.1| leucyl/phenylalanyl-tRNA-protein transferase (L/F-transferase;
           leucyltransferase; phenylalanyltransferase) [Neisseria
           meningitidis WUE 2594]
          Length = 241

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|325129006|gb|EGC51856.1| leucyltransferase [Neisseria meningitidis N1568]
          Length = 241

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|261391741|emb|CAX49190.1| leucyl/phenylalanyl-tRNA--protein transferase (L/F-transferase;
           leucyltransferase; phenylalanyltransferase) [Neisseria
           meningitidis 8013]
          Length = 241

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|239815361|ref|YP_002944271.1| leucyl/phenylalanyl-tRNA--protein transferase [Variovorax paradoxus
           S110]
 gi|239801938|gb|ACS19005.1| leucyl/phenylalanyl-tRNA/protein transferase [Variovorax paradoxus
           S110]
          Length = 251

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 90/164 (54%), Gaps = 5/164 (3%)

Query: 5   ANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRR----ELYDIRINTAFESVISACAQKT 60
           +  Q I W  P  R ++ +  F   + L+K + R       ++RI+  F SVI+AC+Q  
Sbjct: 54  SEDQPILWWSPDPRMVLQVAEFKLHRSLRKTLARFTQTAGCEVRIDHDFASVIAACSQSP 113

Query: 61  Q-KRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHME 119
           +  +  TWI   + +AY+ +   G+AH++E W    L GGLY V LG   FGESMF+   
Sbjct: 114 RTGQSGTWIVPDMVQAYMAMHRAGHAHSVETWIDGQLAGGLYCVGLGRAVFGESMFTRRP 173

Query: 120 NASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY 163
           +ASKI L  LV   ++ Q  ++D Q  T+HL   GA E++  ++
Sbjct: 174 DASKIALAALVCLCRRFQVKMIDCQQNTSHLASLGAREMSRSRF 217


>gi|254468565|ref|ZP_05081971.1| leucyl/phenylalanyl-tRNA--protein transferase [beta proteobacterium
           KB13]
 gi|207087375|gb|EDZ64658.1| leucyl/phenylalanyl-tRNA--protein transferase [beta proteobacterium
           KB13]
          Length = 217

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 91/162 (56%), Gaps = 1/162 (0%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           ++ I W  P  R ++ ++ +   K L K I++  +   IN  F +VI AC +  +K+  T
Sbjct: 54  NEPILWWSPNPRQVLFIDKYKPSKSLLKEIKKNKFIFEINKNFSAVIHACKKVQRKQSGT 113

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDV-LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
           WI+  I   Y  L  +G+AH+ E +  +  LVGG+YG+    VFFGESMF    NASK+C
Sbjct: 114 WIDARIIDNYTRLHQIGHAHSFEIYNMEYSLVGGIYGILSKNVFFGESMFHLENNASKVC 173

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
              L K LK+++  ++D Q  + H+ Q+G   I+  ++  ++
Sbjct: 174 FYFLCKWLKEQEVKIIDAQVESEHISQWGGELISRDKFMDII 215


>gi|59802097|ref|YP_208809.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae FA 1090]
 gi|194099982|ref|YP_002003121.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae NCCP11945]
 gi|239997990|ref|ZP_04717914.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae 35/02]
 gi|240015032|ref|ZP_04721945.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae DGI18]
 gi|240017480|ref|ZP_04724020.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae FA6140]
 gi|240081621|ref|ZP_04726164.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae FA19]
 gi|240113902|ref|ZP_04728392.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae MS11]
 gi|240116634|ref|ZP_04730696.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae PID18]
 gi|240118857|ref|ZP_04732919.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae PID1]
 gi|240122100|ref|ZP_04735062.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae PID24-1]
 gi|240124394|ref|ZP_04737350.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae PID332]
 gi|240124734|ref|ZP_04737620.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae SK-92-679]
 gi|240129071|ref|ZP_04741732.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|254494655|ref|ZP_05107826.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           1291]
 gi|260439605|ref|ZP_05793421.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae DGI2]
 gi|268593842|ref|ZP_06128009.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           35/02]
 gi|268597715|ref|ZP_06131882.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           FA19]
 gi|268599963|ref|ZP_06134130.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           MS11]
 gi|268602299|ref|ZP_06136466.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           PID18]
 gi|268604563|ref|ZP_06138730.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           PID1]
 gi|268683019|ref|ZP_06149881.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           PID332]
 gi|268683313|ref|ZP_06150175.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687448|ref|ZP_06154310.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291042846|ref|ZP_06568587.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           DGI2]
 gi|293398135|ref|ZP_06642340.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           F62]
 gi|75432373|sp|Q5F5Z0|LFTR_NEIG1 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|226737702|sp|B4RR38|LFTR_NEIG2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|59718992|gb|AAW90397.1| putative leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae FA 1090]
 gi|193935272|gb|ACF31096.1| Aat [Neisseria gonorrhoeae NCCP11945]
 gi|226513695|gb|EEH63040.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           1291]
 gi|268547231|gb|EEZ42649.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           35/02]
 gi|268551503|gb|EEZ46522.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           FA19]
 gi|268584094|gb|EEZ48770.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           MS11]
 gi|268586430|gb|EEZ51106.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           PID18]
 gi|268588694|gb|EEZ53370.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           PID1]
 gi|268623303|gb|EEZ55703.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           PID332]
 gi|268623597|gb|EEZ55997.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627732|gb|EEZ60132.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291013280|gb|EFE05246.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           DGI2]
 gi|291611398|gb|EFF40468.1| leucyl/phenylalanyl-tRNA-protein transferase [Neisseria gonorrhoeae
           F62]
 gi|317165433|gb|ADV08974.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 241

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|325283034|ref|YP_004255575.1| leucyl/phenylalanyl-tRNA/protein transferase [Deinococcus
           proteolyticus MRP]
 gi|324314843|gb|ADY25958.1| leucyl/phenylalanyl-tRNA/protein transferase [Deinococcus
           proteolyticus MRP]
          Length = 207

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 86/167 (51%), Gaps = 9/167 (5%)

Query: 12  WIKPLRRGIIPL---ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRP---- 64
           W     R ++PL      H  +RL++ +    +++R N A+  V+  C  +    P    
Sbjct: 37  WFTVDTRALVPLTEDAGLHVSRRLRRKLGH--FEVRRNAAYREVLEGCRGRLPGSPERED 94

Query: 65  TTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKI 124
             WI+  + + Y  L   G AH+ E W+   L GG+ G++LG VFF ES F  + +ASK+
Sbjct: 95  GEWISGEMVELYEHLHAAGLAHSFEVWQGGELAGGVMGLALGGVFFAESKFHRVTDASKV 154

Query: 125 CLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL 171
            L  L +HL  + F +LD Q   +H+ + G  EI+  ++A +L  AL
Sbjct: 155 ALVRLAQHLHAQGFTVLDAQIQNDHIARLGVYEISGAEFAAMLPAAL 201


>gi|71064962|ref|YP_263689.1| leucyl/phenylalanyl-tRNA--protein transferase [Psychrobacter
           arcticus 273-4]
 gi|119367711|sp|Q4FUQ3|LFTR_PSYA2 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|71037947|gb|AAZ18255.1| probable leucyl/phenylalanyl-tRNA--protein transferase
           [Psychrobacter arcticus 273-4]
          Length = 268

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (53%), Gaps = 5/168 (2%)

Query: 6   NSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACA-QKTQKRP 64
           + + I+W  P  R ++    +   K L+K      + + +N AF  VI AC+  ++   P
Sbjct: 68  DDEPIAWWCPEPRCVMQPTDYQPSKSLRKQANNARWQLTLNQAFNEVIHACSLPRSNGLP 127

Query: 65  T---TWINMTIQKAYIDLFYMGYAHTIEAWK-KDVLVGGLYGVSLGAVFFGESMFSHMEN 120
               TWI+  + +AY +L   G+AH++E W  +  LVGGLYG+ +G+++FGESMF    N
Sbjct: 128 EGEHTWIHDDMIEAYNELHAQGFAHSVEVWDDQGQLVGGLYGLKIGSIYFGESMFHIASN 187

Query: 121 ASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLE 168
           ASK+    L++   +    L+D Q    HL   GAI ++  ++   L+
Sbjct: 188 ASKLAFWGLMRLCTQSNVTLVDCQLPNEHLMSLGAITLSRTEFLTQLD 235


>gi|325145399|gb|EGC67676.1| leucyltransferase [Neisseria meningitidis M01-240013]
          Length = 241

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|296313312|ref|ZP_06863253.1| leucyltransferase [Neisseria polysaccharea ATCC 43768]
 gi|296840192|gb|EFH24130.1| leucyltransferase [Neisseria polysaccharea ATCC 43768]
          Length = 242

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 82/164 (50%), Gaps = 6/164 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQK-RPTTWINM 70
           W     R ++  +  H P+ L K +R   Y +  N  FE V++ CA+  +  +  TWI  
Sbjct: 58  WYAVGPRAVVFPDRLHVPRSLAKTLRNRAYRVTANDCFERVVAQCAEMVRPGQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLEN 169
               V  L      L+D Q  T H+R+FG+  +    +A  L +
Sbjct: 178 FACAVPFLASLGVELIDCQQDTEHMRRFGSELLPFADFAARLRS 221


>gi|198275271|ref|ZP_03207802.1| hypothetical protein BACPLE_01430 [Bacteroides plebeius DSM 17135]
 gi|198271854|gb|EDY96124.1| hypothetical protein BACPLE_01430 [Bacteroides plebeius DSM 17135]
          Length = 139

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 80/136 (58%)

Query: 32  LKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAW 91
           ++  + ++ Y +  N AFE VI  C++   ++   W+   + +AYI ++    A ++E W
Sbjct: 1   MRTLMNKDKYKVTFNHAFEQVIRNCSKLRIEQEGAWLGEEMIEAYIRMYEQNLAASVEVW 60

Query: 92  KKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLR 151
           + D LVGGLYGV+LG  FFGESMFS + +ASK+ L  L + L      L+D QF T HL+
Sbjct: 61  EGDKLVGGLYGVTLGTCFFGESMFSLVPSASKLALIRLAQLLHAHGGTLIDCQFETPHLK 120

Query: 152 QFGAIEITHVQYAKLL 167
             G   I++ +Y + L
Sbjct: 121 SMGGRFISYEEYMECL 136


>gi|315638199|ref|ZP_07893381.1| leucyltransferase [Campylobacter upsaliensis JV21]
 gi|315481735|gb|EFU72357.1| leucyltransferase [Campylobacter upsaliensis JV21]
          Length = 210

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 95/168 (56%), Gaps = 6/168 (3%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
           ++ ++W  P  R ++     H  K +KK +   LY+IR++  F S+I+ C      R  +
Sbjct: 38  TKPVNWWCPDPRCVLEPHQIHIQKNMKKALN--LYEIRLDFDFLSLITLC---KNARVRS 92

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICL 126
           WI+    + Y +LF  GYAH++E ++ + LVGG+YG+ +G +FFGESM S  +NASKI +
Sbjct: 93  WIDEEFIQIYHNLFKRGYAHSLELYEGNELVGGIYGLIIGKIFFGESMVSLRKNASKIAM 152

Query: 127 THLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
             L + L+   F L+D Q    HL   GA  I+  ++  +L+    +P
Sbjct: 153 IKLCQLLEPYDF-LIDCQVHNKHLEFMGAKNISRKEFLNILDEKCHNP 199


>gi|161870855|ref|YP_001600028.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis 053442]
 gi|304389018|ref|ZP_07371064.1| leucyltransferase [Neisseria meningitidis ATCC 13091]
 gi|189046556|sp|A9M3H4|LFTR_NEIM0 RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|161596408|gb|ABX74068.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis 053442]
 gi|304336999|gb|EFM03187.1| leucyltransferase [Neisseria meningitidis ATCC 13091]
          Length = 241

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGHAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|78776657|ref|YP_392972.1| leucyl/phenylalanyl-tRNA--protein transferase [Sulfurimonas
           denitrificans DSM 1251]
 gi|119368217|sp|Q30TE4|LFTR_SULDN RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|78497197|gb|ABB43737.1| Leucyltransferase [Sulfurimonas denitrificans DSM 1251]
          Length = 228

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 88/151 (58%), Gaps = 3/151 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQ-KTQKRPTTWI 68
           I W  P  R I+ L+ F   + L+K +++  ++ R +T F +V+  C   K  K+  TWI
Sbjct: 53  IIWWSPNPRLIMELDDFKLSRSLRKSMKK--FEYRFDTNFINVMKNCQNIKRVKQDGTWI 110

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
              I +AY  L  MG AH++E++    LVGGLYGV++G +F GESMF+ + +ASK     
Sbjct: 111 QDEIIEAYSVLHDMGIAHSVESYLDGELVGGLYGVAVGGLFCGESMFTLVNDASKSAYAV 170

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEIT 159
           L+ HLK   +  +D Q  T HL+  GA E++
Sbjct: 171 LINHLKIWGYDFIDAQVPTEHLKNLGAKEVS 201


>gi|296113838|ref|YP_003627776.1| leucyl/phenylalanyl-tRNA-protein transferase [Moraxella catarrhalis
           RH4]
 gi|295921532|gb|ADG61883.1| leucyl/phenylalanyl-tRNA-protein transferase [Moraxella catarrhalis
           RH4]
 gi|326561406|gb|EGE11756.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis 46P47B1]
 gi|326562178|gb|EGE12506.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis 7169]
 gi|326565639|gb|EGE15802.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis 12P80B1]
 gi|326566209|gb|EGE16361.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis 103P14B1]
 gi|326567136|gb|EGE17258.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis BC1]
 gi|326572303|gb|EGE22298.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis BC8]
 gi|326574897|gb|EGE24827.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis 101P30B1]
 gi|326576225|gb|EGE26140.1| leucyl/phenylalanyl-tRNA--protein transferase [Moraxella
           catarrhalis CO72]
          Length = 255

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 89/172 (51%), Gaps = 4/172 (2%)

Query: 7   SQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTT 66
            + I W  P  R +I    F+  K L +  +++ + I  N  FE+VI+AC    +    T
Sbjct: 63  DEPICWWSPEIRCVITPNDFYPSKSLIRTAKKQPWTITTNADFEAVINACRAPRRDTFQT 122

Query: 67  WINMTIQKAYIDLFYMGYAHTIEAWK----KDVLVGGLYGVSLGAVFFGESMFSHMENAS 122
           WI+  +  AY  LF +G A +IE W        L+GGLYGVS G++F GESMF    +AS
Sbjct: 123 WIHDNMVLAYRQLFKIGAAASIEVWAGMPYDSELIGGLYGVSFGSIFCGESMFHRRNDAS 182

Query: 123 KICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKHP 174
           KI    L+    +    L+D Q    HLR+ GA  +   ++ +LL++ +  P
Sbjct: 183 KIAFWALMHWANQYGIQLIDCQLENPHLRRLGANLMPRDEFLELLKHLVMTP 234


>gi|220904696|ref|YP_002480008.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868995|gb|ACL49330.1| leucyl/phenylalanyl-tRNA/protein transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 264

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 99/167 (59%), Gaps = 2/167 (1%)

Query: 10  ISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWIN 69
           I W  P  R ++PL+ FH P+R  +++R + +++ +N AF  VI ACA    +   TWI 
Sbjct: 46  ILWWSPDPRCVLPLDAFHLPRRSARHLRNKPFELTLNAAFSEVIHACAAPRHEGGGTWIL 105

Query: 70  MTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTHL 129
             + +AY  L +MGYAH++EAW +  LVGGLYGV LG  FFGESMF  +  AS+  L  L
Sbjct: 106 PEMAEAYQCLHHMGYAHSVEAWHEGELVGGLYGVGLGRAFFGESMFHVLPEASRAALAGL 165

Query: 130 VKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENAL--KHP 174
           V  L+ R   LLD Q  T H+ + G + +    + + L+ AL  +HP
Sbjct: 166 VALLRLRGVTLLDCQQETPHIMKMGGVLLPRELFVQKLDQALAPEHP 212


>gi|313667516|ref|YP_004047800.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria lactamica
           ST-640]
 gi|313004978|emb|CBN86406.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria lactamica
           020-06]
          Length = 261

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R +I  E  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 78  WYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVTVNGCFAEVVAHCAAAARPNQDGTWIAP 137

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MG+AH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 138 EFQTAYLKLHEMGHAHSFECHYPDESGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIA 197

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 198 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 239


>gi|300869487|ref|ZP_07114069.1| leucyl/phenylalanyl-tRNA--protein transferase [Oscillatoria sp. PCC
           6506]
 gi|300332460|emb|CBN59267.1| leucyl/phenylalanyl-tRNA--protein transferase [Oscillatoria sp. PCC
           6506]
          Length = 194

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 92/165 (55%), Gaps = 5/165 (3%)

Query: 10  ISWIKPLRRGIIPL-ETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKRPTTWI 68
           ++W     R +IPL E F  P+ L++ + +  +   +N  F++V+  CA     R  TWI
Sbjct: 29  LNWYSSRERSLIPLDERFTYPRSLRRSLNQNRFTTAVNRDFKAVVEGCA----NREETWI 84

Query: 69  NMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASKICLTH 128
           +  +++ Y  L   G+A++ E W+ D L GG+ G+ +G  F GESMF  +   SK+ +  
Sbjct: 85  SPQLKEIYHALNQAGWAYSFETWQGDELAGGILGIVIGGAFIGESMFYRIPEGSKVAMVK 144

Query: 129 LVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLLENALKH 173
           LV+ L+ R F+L D Q    HL +FG+  I + QY  LL+ AL+ 
Sbjct: 145 LVERLRDRSFVLFDAQMTNPHLERFGSYIINNKQYQSLLKKALQR 189


>gi|254805752|ref|YP_003083973.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis alpha14]
 gi|254669294|emb|CBA08263.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis alpha14]
          Length = 241

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70
           W     R ++  +  H P+ L K +R   Y + +N  F  V++ CA   +  +  TWI  
Sbjct: 58  WYAVGPRAVVFPDRLHIPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAP 117

Query: 71  TIQKAYIDLFYMGYAHTIEAWKKDV-----LVGGLYGVSLGAVFFGESMFSHMENASKIC 125
             Q AY+ L  MGYAH+ E    D      L GG YGV +G VF+GESMF+   +ASKI 
Sbjct: 118 EFQTAYLKLHEMGYAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIA 177

Query: 126 LTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
               V  L      L+D Q  T H+R+FG+  +    +A+ L
Sbjct: 178 FACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERL 219


>gi|158312849|ref|YP_001505357.1| leucyl/phenylalanyl-tRNA--protein transferase [Frankia sp. EAN1pec]
 gi|158108254|gb|ABW10451.1| Leucyltransferase [Frankia sp. EAN1pec]
          Length = 320

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 78/164 (47%), Gaps = 3/164 (1%)

Query: 4   SANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQKR 63
             +  D  W  P  R ++        + L   +R   +   +N  F  V+ AC +     
Sbjct: 108 PGDDVDPPWWCPDPRTVLAPGEMRIRRSLIIRMRNSTWTSTLNECFVDVVRACRRDG--- 164

Query: 64  PTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLGAVFFGESMFSHMENASK 123
           P  WI   + + Y  L  +G+AH++E W+ D LVGG+YGV +G VF GESMF    +ASK
Sbjct: 165 PHQWITEQLIEGYARLHALGWAHSVEIWEGDALVGGMYGVQVGRVFMGESMFHRASDASK 224

Query: 124 ICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQYAKLL 167
           + L   +    +    LLD+Q  T HL   GA E+   ++   L
Sbjct: 225 VALVDFLDRFGRAGGALLDVQLTTAHLTTLGAREVPRAEFLATL 268


>gi|15676133|ref|NP_273264.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis MC58]
 gi|33301329|sp|Q9K1E9|LFTR_NEIMB RecName: Full=Leucyl/phenylalanyl-tRNA--protein transferase;
           AltName: Full=L/F-transferase; AltName:
           Full=Leucyltransferase; AltName:
           Full=Phenyalanyltransferase
 gi|7225427|gb|AAF40663.1| leucyl/phenylalanyl-tRNA--protein transferase [Neisseria
           meningitidis MC58]
          Length = 241

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 6/162 (3%)

Query: 12  WIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRINTAFESVISACAQKTQ-KRPTTWINM 70