254780270

254780270

ATP-dependent protease La

GeneID in NCBI database:8209251Locus tag:CLIBASIA_00775
Protein GI in NCBI database:254780270Protein Accession:YP_003064683.1
Gene range:-(151069, 153531)Protein Length:820aa
Gene description:ATP-dependent protease La
COG prediction:[O] ATP-dependent Lon protease, bacterial type
KEGG prediction:lon; ATP-dependent protease La; K01338 ATP-dependent Lon protease [EC:3.4.21.53]
SEED prediction:ATP-dependent protease La (EC 3.4.21.53) Type I
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteasome bacterial;
Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820
MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH
ccccHHHHHHccccccccccccccccEEEEEEccccEEccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHccccEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEEEccccccHHHHcccccccccccHHHHHHHHHHHHHHccEEEEEcHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEcccccEEEEEEcccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHccHHHcccccccccccEEEEEccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccccccHHHHHHHHHHHccccccccEEEEEEcccccEEEEcccHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccccccccccccccccccccccccccccccc
ccHHHHHHHccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHcccEEEEHHcccccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHcHccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHccHEEEEHcccccccHHEcccccEEEccccHHHHHHHHHccccccHHHHHHHHHHcHcccccHHHHHHHHccHHHcccccccEEEEEcccccEEEEEEcccccccccHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHccccEEEcccEcccccEEEEEEEEEEEccccEEEEEEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccHHccccEEEEccccccccccccHHHHHHHHHHHHHcccccHHHEEccEEEEEccEEEcccHHHHHHHHHHHccccEEEEccHcHHHHHHccHHHHHcccEEEHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
mnqsdekreyvtcedeskdrcgadgiiypllplrdivvfpYMIVPLFVGREKSVRALDEAMNSHKKIILVTQmnsndenpiassvyrigTIVDIVQilrlpdgtvKILVEGSVRARIVEYIEREDFLEAITqvlpdptedpveLEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELdngeegrdeISDFEARISKIRLSKEAREKALSELQKLrqmnplsaesSVVRNYLDWLlgvpwdkksktkkNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLilcfvgppgvgktsLAQSIAKATGRQYVrmslggvydeadirghrrtyigsmpGRIIQSLKRAKRSNPLLLLDEIDKmgsdlrgdpsaALLEvldpaqnssfvdhYLEVEYDLSDVMFIMTANtlniplplmdRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALkqeeccisdGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKnsdttvsinennlqdylgvprykygkiegedqVGIVTGLAWtevggeiltvegvimpgkgeitiTGNLKEIMKESILAASSYVRskattfgiipsafneinihvhvpegatpkdgpsagIAMATAIVSIMTCIPVyknvamtgeltlrgrvlpigGLKEKLLAALRAGVTkvlipeenikdlmdipenvkngleiipvSFMGEVLKHALlrmpdplesegnksiplsvegivvgkdgrsvah
mnqsdekreyvtcedeskdrcgadGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVtqmnsndenpIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMeseisvlqvekRIRSRVKRQMEKTQREYYLHEQMKAIQKeldngeegrdeISDFEARISKIRLSKEAREKALSElqklrqmnplsaessVVRNYLDWLLgvpwdkksktkKNLDFAIRIldqdhfgleKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMslggvydeadirgHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTlniplplmDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTkivknsdttvsinennlqdylgVPRYKYGKIEGEDQVGIVTGLAWTEVGGEIltvegvimpgkGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVtkvlipeenikdlmdIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLesegnksiplsvegivvgkdgrsvah
MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH
***************************YPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLP*******E*EALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEK************TQREYYLHEQMKAIQKEL************F*******************************A*SSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMP*****************************
*****************KDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH
MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLE*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYYLHEQMKAIQKELDNGEEGRDEISDFEARISKxxxxxxxxxxxxxxxxxxxxxNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH
MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH
MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target820 ATP-dependent protease La [Candidatus Liberibacter asia
254780877853 ATP-dependent Clp protease, ATP-binding subunit pr 8e-05
254780545647 metalloprotease [Candidatus Liberibacter asiaticus 1e-04
254780552334 Holliday junction DNA helicase RuvB [Candidatus Li 4e-04
254780163798 ATP-dependent Clp protease ATP-binding subunit [Ca 5e-04
254780163 798 ATP-dependent Clp protease ATP-binding subunit [Ca 0.002
254780334479 DNA repair protein RadA [Candidatus Liberibacter a 0.023
>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Back     alignment 
 Score = 40.8 bits (94), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 21/131 (16%)

Query: 369 LCFVGPPGVGKTSLAQSIAK---ATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQ 425
             F+GP GVGKT L +S+A+         +R+ +    ++  +       IGS PG +  
Sbjct: 601 FMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSV----SRLIGSPPGYVGY 656

Query: 426 ----SLKRAKRSNP--LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD 479
               +L  A R +P  ++L DEI+K  SD+       LL+VLD  + +      +    D
Sbjct: 657 EEGGALTEAVRRHPYQVVLFDEIEKAHSDVHN----ILLQVLDDGRLTDSQGRTV----D 708

Query: 480 LSDVMFIMTAN 490
             + + IMT+N
Sbjct: 709 FRNTLIIMTSN 719
>gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Back     alignment 
 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 339 QDHFGLEKVKE---RIIEYLAVQMRVIKNKGLI---LCFVGPPGVGKTSLAQSIAKATGR 392
           +D  G+++ KE    I+++L    +  +  G I   +  VGPPG GKT LA+++A     
Sbjct: 148 KDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANV 207

Query: 393 QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMG 446
            +  +S G  + E         ++G    R+    ++AK ++P ++ +DEID +G
Sbjct: 208 PFFTIS-GSDFVE--------LFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVG 253
>gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Back     alignment 
 Score = 38.5 bits (88), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 80/182 (43%), Gaps = 40/182 (21%)

Query: 369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLK 428
           + FVGPPG+GKT+LAQ +A+  G  + R + G V  +A   G     + ++  R +    
Sbjct: 57  VLFVGPPGLGKTTLAQVVARELGVNF-RSTSGPVIAKA---GDLAALLTNLEDRDV---- 108

Query: 429 RAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYL-------EVEYDLS 481
                   L +DEI ++        S  + E+L PA     +D  +        V+ +LS
Sbjct: 109 --------LFIDEIHRL--------SIIVEEILYPAMEDFQLDLMVGEGPSARSVKINLS 152

Query: 482 DVMFIMTANTLNIPL---PLMDRMEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEE 537
              F + A T  + L   PL DR  I IR+  Y E E L+       K  LT  A+  E 
Sbjct: 153 --RFTLIAATTRVGLLTNPLQDRFGIPIRLNFY-EIEDLKTIVQRGAK--LTGLAVTDEA 207

Query: 538 CC 539
            C
Sbjct: 208 AC 209
>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment 
 Score = 38.1 bits (87), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 14/102 (13%)

Query: 368 ILCFV--GPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIR---GHRRTYIGSMPGR 422
           I C+V  GP GVGKT +++ +A A G Q +R  +    +   +    G    Y+G   G 
Sbjct: 507 IGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG 566

Query: 423 IIQSLKRAKRSNP--LLLLDEIDKMGSDLRGDPSAALLEVLD 462
           I   L  +   NP  ++LLDEI+K   D+       LL+++D
Sbjct: 567 I---LADSVDQNPYSVVLLDEIEKSHPDVLN----ILLQIMD 601
>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment 
 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 75/174 (43%), Gaps = 29/174 (16%)

Query: 317 GVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILC------ 370
           G   D ++KT  NL  A+     D    EKVK+  ++ L  +   I     ILC      
Sbjct: 170 GFVNDYQAKTDLNLFPALSAYCVDL--TEKVKKGKVDILVGRHEEINRTIQILCRRSKNN 227

Query: 371 --FVGPPGVGKTSLAQSIAKAT----------GRQYVRMSLGGVYDEADIRGHRRTYIGS 418
             +VG PGVGKT++A+  AK            G +   + +G +     I G R  Y G 
Sbjct: 228 PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL-----IAGTR--YRGD 280

Query: 419 MPGRIIQSLKRAKR-SNPLLLLDEIDKM-GSDLRGDPSAALLEVLDPAQNSSFV 470
              RI + +K  +  +N +L +DEI  + G+      S     +L PA +S  V
Sbjct: 281 FEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAV 334
>gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Back     alignment 
 Score = 32.7 bits (73), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 675 FNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGG 734
           F   ++H+++  G    + P+A +A+A A++S +  IP+  +    GE++L G V  +G 
Sbjct: 353 FGNHDVHLNIAGGYRISE-PAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGH 411

Query: 735 LKEKLLAALRAGVTKVLIPE 754
           ++++L  A + G    + PE
Sbjct: 412 MQQRLKEAEKIGFLSGVFPE 431

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target820 ATP-dependent protease La [Candidatus Liberibacter asia
315122828820 ATP-dependent protease La [Candidatus Liberibacter sola 1 0.0
86357226805 ATP-dependent protease LA protein [Rhizobium etli CFN 4 1 0.0
209548852805 ATP-dependent protease La [Rhizobium leguminosarum bv. 1 0.0
222148266867 ATP-dependent protease La [Agrobacterium vitis S4] Leng 1 0.0
190891274805 ATP-dependent protease La protein [Rhizobium etli CIAT 1 0.0
241204075805 ATP-dependent protease La [Rhizobium leguminosarum bv. 1 0.0
116251456805 ATP-dependent protease [Rhizobium leguminosarum bv. vic 1 0.0
325292628805 ATP-dependent protease La [Agrobacterium sp. H13-3] Len 1 0.0
15888590805 ATP-dependent protease LA [Agrobacterium tumefaciens st 1 0.0
222085566806 ATP-dependent protease LA protein [Agrobacterium radiob 1 0.0
>gi|315122828|ref|YP_004063317.1| ATP-dependent protease La [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 820 Back     alignment and organism information
 Score = 1438 bits (3722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/820 (84%), Positives = 765/820 (93%)

Query: 1   MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVPLFVGREKSVRALDEA 60
           MNQ DEK+  +T E   KDRC  D +IYPLLPLRDIVVFP+MIVPLFVGREKS+RALDEA
Sbjct: 1   MNQDDEKKIGITSESADKDRCAVDNVIYPLLPLRDIVVFPHMIVPLFVGREKSIRALDEA 60

Query: 61  MNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGTVKILVEGSVRARIVEY 120
           M SHKKI+LVTQ+NS++ENPIASSVYRIGTIVDI+QILRLPD TVKILVEGSVRARI+EY
Sbjct: 61  MASHKKIVLVTQLNSDEENPIASSVYRIGTIVDILQILRLPDDTVKILVEGSVRARIIEY 120

Query: 121 IEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNKKISPEVIGITSQIEGFS 180
           IEREDF+EAITQV  DP ED +E+EALSRSVI+EFSNYIK NKKISPEV+G T+QIE FS
Sbjct: 121 IEREDFVEAITQVCLDPVEDAIEIEALSRSVISEFSNYIKFNKKISPEVMGTTTQIEDFS 180

Query: 181 KLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEISVLQVEKRIRSRVKRQMEK 240
           KL+DV+AANLSIKV +RQKILEA+SVKERLE+LLV ME EIS+LQ+EKRIRSRVKRQMEK
Sbjct: 181 KLSDVVAANLSIKVIDRQKILEAISVKERLEILLVLMEGEISILQIEKRIRSRVKRQMEK 240

Query: 241 TQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLSKEAREKALSELQKLRQMNP 300
           TQREYYL+EQMKAIQKELD+GEEG DEI DFE RIS+ +LSKEAREKALSELQKLRQMNP
Sbjct: 241 TQREYYLNEQMKAIQKELDDGEEGCDEIRDFEVRISRTKLSKEAREKALSELQKLRQMNP 300

Query: 301 LSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMR 360
           LSAESSVVRNYLDWLLGVPWDKKSKTKK+LDFA  ILDQDHFGLEKVKERIIEYLAVQMR
Sbjct: 301 LSAESSVVRNYLDWLLGVPWDKKSKTKKDLDFATHILDQDHFGLEKVKERIIEYLAVQMR 360

Query: 361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMP 420
           V KNKGLILCFVGPPGVGKTSLAQSIA+ATGRQYVR+SLGGVYDE+DIRGHRRTYIGSMP
Sbjct: 361 VAKNKGLILCFVGPPGVGKTSLAQSIARATGRQYVRISLGGVYDESDIRGHRRTYIGSMP 420

Query: 421 GRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDL 480
           GRIIQSLK+AK+SNPLLLLDE+DKMGSDLRGDPSAALLEVLDPAQNS+FVDHYLEVEYDL
Sbjct: 421 GRIIQSLKKAKKSNPLLLLDEVDKMGSDLRGDPSAALLEVLDPAQNSTFVDHYLEVEYDL 480

Query: 481 SDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCI 540
           SDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHL+KKVL E+AL+ EE  +
Sbjct: 481 SDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLLKKVLRENALRAEEFSV 540

Query: 541 SDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRY 600
           +D VLLDIIR FT EAGVR+ ER+LMK+ARKAVTKIVK S+  VS+NE+NLQDYLG+PRY
Sbjct: 541 NDAVLLDIIRSFTREAGVRNLERSLMKLARKAVTKIVKGSEQMVSVNEDNLQDYLGIPRY 600

Query: 601 KYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGKGEITITGNLKEIMKESILAASSY 660
           +YGK+EGE+QVGIVTGLAWTEVGGEILTVEGVIMPGKG+ITITGNLKEIMKESILAASSY
Sbjct: 601 QYGKMEGENQVGIVTGLAWTEVGGEILTVEGVIMPGKGKITITGNLKEIMKESILAASSY 660

Query: 661 VRSKATTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMT 720
           VRS+A TFGI PSAFN+ NIHVHVPE ATPKDGPSAGIAMATA+VS+MT IPVYKNVAMT
Sbjct: 661 VRSRAMTFGISPSAFNDTNIHVHVPEAATPKDGPSAGIAMATAVVSVMTSIPVYKNVAMT 720

Query: 721 GELTLRGRVLPIGGLKEKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMG 780
           GELTLRGR+LPIGGLKEKLLAALRAG+TKVLIPEEN+KDLM++PEN+KN LEIIPVSFM 
Sbjct: 721 GELTLRGRILPIGGLKEKLLAALRAGITKVLIPEENVKDLMEMPENIKNRLEIIPVSFME 780

Query: 781 EVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGRSVAH 820
           EVL+HALLRMPDP+ESE    +PLSVE  V+GK  +++AH
Sbjct: 781 EVLRHALLRMPDPIESEDINPLPLSVEEDVMGKSEQTIAH 820



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357226|ref|YP_469118.1| ATP-dependent protease LA protein [Rhizobium etli CFN 42] Length = 805 Back     alignment and organism information
>gi|209548852|ref|YP_002280769.1| ATP-dependent protease La [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 805 Back     alignment and organism information
>gi|222148266|ref|YP_002549223.1| ATP-dependent protease La [Agrobacterium vitis S4] Length = 867 Back     alignment and organism information
>gi|190891274|ref|YP_001977816.1| ATP-dependent protease La protein [Rhizobium etli CIAT 652] Length = 805 Back     alignment and organism information
>gi|241204075|ref|YP_002975171.1| ATP-dependent protease La [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 805 Back     alignment and organism information
>gi|116251456|ref|YP_767294.1| ATP-dependent protease [Rhizobium leguminosarum bv. viciae 3841] Length = 805 Back     alignment and organism information
>gi|325292628|ref|YP_004278492.1| ATP-dependent protease La [Agrobacterium sp. H13-3] Length = 805 Back     alignment and organism information
>gi|15888590|ref|NP_354271.1| ATP-dependent protease LA [Agrobacterium tumefaciens str. C58] Length = 805 Back     alignment and organism information
>gi|222085566|ref|YP_002544096.1| ATP-dependent protease LA protein [Agrobacterium radiobacter K84] Length = 806 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target820 ATP-dependent protease La [Candidatus Liberibacter asia
KOG2004906 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent 0.0
TIGR00763775 TIGR00763, lon, ATP-dependent protease La 0.0
PRK10787784 PRK10787, PRK10787, DNA-binding ATP-dependent protease 0.0
COG0466782 COG0466, Lon, ATP-dependent Lon protease, bacterial typ 0.0
pfam05362205 pfam05362, Lon_C, Lon protease (S16) C-terminal proteol 9e-98
PRK13765637 PRK13765, PRK13765, ATP-dependent protease Lon; Provisi 2e-32
TIGR00764608 TIGR00764, lon_rel, lon-related putative ATP-dependent 3e-29
TIGR02903615 TIGR02903, spore_lon_C, ATP-dependent protease, Lon fam 7e-24
COG1067647 COG1067, LonB, Predicted ATP-dependent protease [Posttr 7e-23
TIGR02653675 TIGR02653, Lon_rel_chp, conserved hypothetical protein 2e-12
pfam02190193 pfam02190, LON, ATP-dependent protease La (LON) domain 1e-39
COG2802221 COG2802, COG2802, Uncharacterized protein, similar to t 5e-13
TIGR02902531 TIGR02902, spore_lonB, ATP-dependent protease LonB 3e-26
pfam00004131 pfam00004, AAA, ATPase family associated with various c 1e-20
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 4e-13
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 1e-08
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 5e-07
smart00382148 smart00382, AAA, ATPases associated with a variety of c 9e-07
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-05
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebrand fac 1e-04
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 3e-04
KOG1808 1856 KOG1808, KOG1808, KOG1808, AAA ATPase containing von Wi 5e-04
COG2255332 COG2255, RuvB, Holliday junction resolvasome, helicase 7e-04
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-binding 0.004
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 2e-11
KOG2170344 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfami 2e-05
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [ 3e-05
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 1e-09
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regulatory 1e-04
KOG0731774 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing 2e-04
COG1750 579 COG1750, COG1750, Archaeal serine proteases [General fu 6e-09
PRK11823446 PRK11823, PRK11823, DNA repair protein RadA; Provisiona 9e-09
COG3480342 COG3480, SdrC, Predicted secreted protein containing a 6e-07
COG1066456 COG1066, Sms, Predicted ATP-dependent serine protease [ 6e-07
TIGR00416454 TIGR00416, sms, DNA repair protein RadA 1e-04
PRK13342413 PRK13342, PRK13342, recombination factor protein RarA; 1e-08
PRK04195482 PRK04195, PRK04195, replication factor C large subunit; 9e-05
COG2256436 COG2256, MGS1, ATPase related to the helicase subunit o 1e-04
KOG0734752 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing 1e-04
pfam01695178 pfam01695, IstB, IstB-like ATP binding protein 4e-04
PRK13341 725 PRK13341, PRK13341, recombination factor protein RarA/u 5e-04
TIGR02880284 TIGR02880, cbbX_cfxQ, probable Rubsico expression prote 0.001
KOG0726440 KOG0726, KOG0726, KOG0726, 26S proteasome regulatory co 0.004
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 fa 2e-06
KOG1051898 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related 1e-05
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH 2e-05
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed 2e-04
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttranslat 0.004
COG0606 490 COG0606, COG0606, Predicted ATPase with chaperone activ 3e-05
COG0542786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 3e-05
smart0046492 smart00464, LON, Found in ATP-dependent protease La (LO 3e-05
KOG4658 889 KOG4658, KOG4658, KOG4658, Apoptotic ATPase [Signal tra 2e-04
smart00763361 smart00763, AAA_PrkA, PrkA AAA domain 0.001
pfam08298358 pfam08298, AAA_PrkA, PrkA AAA domain 0.004
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisional 0.003
>gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|114104 pfam05362, Lon_C, Lon protease (S16) C-terminal proteolytic domain Back     alignment and domain information
>gnl|CDD|184312 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional Back     alignment and domain information
>gnl|CDD|162029 TIGR00764, lon_rel, lon-related putative ATP-dependent protease Back     alignment and domain information
>gnl|CDD|163066 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family Back     alignment and domain information
>gnl|CDD|31266 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131701 TIGR02653, Lon_rel_chp, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|145377 pfam02190, LON, ATP-dependent protease La (LON) domain Back     alignment and domain information
>gnl|CDD|32634 COG2802, COG2802, Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only] Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|37019 KOG1808, KOG1808, KOG1808, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|32436 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|37381 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31415 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35950 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31936 COG1750, COG1750, Archaeal serine proteases [General function prediction only] Back     alignment and domain information
>gnl|CDD|183326 PRK11823, PRK11823, DNA repair protein RadA; Provisional Back     alignment and domain information
>gnl|CDD|33283 COG3480, SdrC, Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|161868 TIGR00416, sms, DNA repair protein RadA Back     alignment and domain information
>gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|179778 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35953 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|110677 pfam01695, IstB, IstB-like ATP binding protein Back     alignment and domain information
>gnl|CDD|183985 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|131926 TIGR02880, cbbX_cfxQ, probable Rubsico expression protein CbbX Back     alignment and domain information
>gnl|CDD|35945 KOG0726, KOG0726, KOG0726, 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163222 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162266 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|30813 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|128740 smart00464, LON, Found in ATP-dependent protease La (LON) Back     alignment and domain information
>gnl|CDD|39857 KOG4658, KOG4658, KOG4658, Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|129002 smart00763, AAA_PrkA, PrkA AAA domain Back     alignment and domain information
>gnl|CDD|116881 pfam08298, AAA_PrkA, PrkA AAA domain Back     alignment and domain information
>gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 820 ATP-dependent protease La [Candidatus Liberibacter asia
TIGR00763941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 100.0
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 100.0
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 100.0
KOG2004906 consensus 100.0
pfam05362205 Lon_C Lon protease (S16) C-terminal proteolytic domain. 100.0
TIGR02653677 Lon_rel_chp conserved hypothetical protein; InterPro: I 99.64
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 99.45
COG4930683 Predicted ATP-dependent Lon-type protease [Posttranslat 99.23
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 100.0
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 100.0
PRK13765637 ATP-dependent protease Lon; Provisional 100.0
COG1067647 LonB Predicted ATP-dependent protease [Posttranslationa 100.0
TIGR00764662 lon_rel ATP-dependent protease, putative; InterPro: IPR 99.93
pfam02190193 LON ATP-dependent protease La (LON) domain. 99.98
COG2802221 Uncharacterized protein, similar to the N-terminal doma 99.95
KOG4159398 consensus 99.12
smart0046492 LON Found in ATP-dependent protease La (LON). N-termina 98.76
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.9
PRK10865857 protein disaggregation chaperone; Provisional 99.88
CHL00095823 clpC Clp protease ATP binding subunit 99.82
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.78
PRK04195403 replication factor C large subunit; Provisional 99.64
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 99.63
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 99.62
PRK00440318 rfc replication factor C small subunit; Reviewed 99.56
CHL00181287 cbbX CbbX; Provisional 99.54
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 99.49
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.43
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 99.25
KOG0991333 consensus 98.54
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.88
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.82
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 99.68
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 97.78
PRK11823454 DNA repair protein RadA; Provisional 99.73
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 99.06
CHL00195491 ycf46 Ycf46; Provisional 99.72
PRK03992390 proteasome-activating nucleotidase; Provisional 99.72
PRK13342417 recombination factor protein RarA; Reviewed 99.67
CHL00176631 ftsH cell division protein; Validated 99.59
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.59
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.58
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.49
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.45
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 99.41
KOG0738491 consensus 99.38
PRK06647560 DNA polymerase III subunits gamma and tau; Validated 99.37
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 99.36
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 99.36
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 99.35
KOG0730693 consensus 99.32
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 99.29
PRK09862506 putative ATP-dependent protease; Provisional 99.29
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 99.28
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.28
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.24
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.21
KOG0733802 consensus 99.15
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 99.08
PRK05022510 anaerobic nitric oxide reductase transcription regulato 99.07
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 99.04
KOG2028554 consensus 99.04
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.0
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.99
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.99
PRK10365441 transcriptional regulatory protein ZraR; Provisional 98.97
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.96
KOG0737386 consensus 98.95
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.93
KOG0740428 consensus 98.88
PTZ00112650 origin recognition complex 1 protein; Provisional 98.87
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 98.86
PRK06893229 DNA replication initiation factor; Validated 98.85
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 98.79
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 98.79
KOG0730693 consensus 98.78
PRK08903227 hypothetical protein; Validated 98.77
PRK05642234 DNA replication initiation factor; Validated 98.73
KOG0727408 consensus 98.73
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.72
KOG0478804 consensus 98.71
KOG0736953 consensus 98.68
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 98.67
PRK08084235 DNA replication initiation factor; Provisional 98.67
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.65
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.6
PRK08727233 hypothetical protein; Validated 98.53
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.51
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.4
KOG0735952 consensus 98.34
PRK09087226 hypothetical protein; Validated 98.22
KOG2680454 consensus 98.13
COG1221403 PspF Transcriptional regulators containing an AAA-type 98.08
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.05
KOG1514767 consensus 98.03
KOG2227529 consensus 97.94
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.85
PRK05818262 DNA polymerase III subunit delta'; Validated 97.31
KOG0477854 consensus 96.46
COG4650531 RtcR Sigma54-dependent transcription regulator containi 95.1
COG4240300 Predicted kinase [General function prediction only] 94.67
COG1750 579 Archaeal serine proteases [General function prediction 99.68
TIGR00368 505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 98.65
PRK09862 506 putative ATP-dependent protease; Provisional 98.47
COG0606 490 Predicted ATPase with chaperone activity [Posttranslati 97.92
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.79
pfam00004131 AAA ATPase family associated with various cellular acti 99.67
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.66
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.52
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.43
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.38
KOG0736953 consensus 99.3
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.91
KOG0728404 consensus 98.78
PRK07132303 DNA polymerase III subunit delta'; Validated 98.6
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 98.58
smart00382148 AAA ATPases associated with a variety of cellular activ 98.58
PRK08058329 DNA polymerase III subunit delta'; Validated 98.57
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 98.56
PRK08769319 DNA polymerase III subunit delta'; Validated 98.41
PRK05917290 DNA polymerase III subunit delta'; Validated 98.33
PRK05707328 DNA polymerase III subunit delta'; Validated 98.22
PRK06871324 DNA polymerase III subunit delta'; Validated 98.13
PRK06090319 DNA polymerase III subunit delta'; Validated 98.1
pfam03266168 DUF265 Protein of unknown function, DUF265. 98.07
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 97.9
PRK08699325 DNA polymerase III subunit delta'; Validated 97.9
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 97.89
PRK07993334 DNA polymerase III subunit delta'; Validated 97.67
pfam00931285 NB-ARC NB-ARC domain. 97.43
PRK13531498 regulatory ATPase RavA; Provisional 97.41
PRK06964342 DNA polymerase III subunit delta'; Validated 97.37
KOG1808 1856 consensus 97.25
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.22
PRK06526254 transposase; Provisional 97.13
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 97.04
PRK08181269 transposase; Validated 97.01
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 96.95
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.85
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.56
cd03114148 ArgK-like The function of this protein family is unkown 96.48
PRK00771433 signal recognition particle protein Srp54; Provisional 96.38
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 96.18
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 95.72
PRK10867453 signal recognition particle protein; Provisional 94.79
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.6
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 99.44
KOG0745564 consensus 99.25
KOG0735952 consensus 98.71
PRK12422455 chromosomal replication initiation protein; Provisional 98.21
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.12
PRK06620214 hypothetical protein; Validated 97.82
COG0714329 MoxR-like ATPases [General function prediction only] 99.57
KOG0731774 consensus 99.47
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 99.1
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.98
PRK05564313 DNA polymerase III subunit delta'; Validated 98.97
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.92
KOG0744423 consensus 98.78
PRK07471363 DNA polymerase III subunit delta'; Validated 98.73
KOG0739439 consensus 98.73
smart00350509 MCM minichromosome maintenance proteins. 98.72
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.71
KOG2170344 consensus 98.65
PRK07399314 DNA polymerase III subunit delta'; Validated 98.62
KOG0652424 consensus 98.56
PRK07940395 DNA polymerase III subunit delta'; Validated 98.52
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 98.5
PTZ00111916 DNA replication licensing factor MCM4; Provisional 98.43
KOG0726440 consensus 98.38
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 98.18
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.14
KOG0742630 consensus 98.06
PRK07276290 DNA polymerase III subunit delta'; Validated 97.94
KOG0480764 consensus 97.39
KOG1970634 consensus 97.33
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 97.3
PRK09183258 transposase/IS protein; Provisional 97.15
KOG0990360 consensus 97.05
KOG0482721 consensus 96.87
PRK09435325 arginine/ornithine transport system ATPase; Provisional 96.53
COG2766649 PrkA Putative Ser protein kinase [Signal transduction m 95.88
pfam05272198 VirE Virulence-associated protein E. This family contai 95.6
KOG0479818 consensus 94.64
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.5
PRK12402337 replication factor C small subunit 2; Reviewed 99.45
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.41
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 99.38
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 99.28
KOG0733 802 consensus 99.27
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.19
KOG0989346 consensus 99.06
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 99.05
KOG0651388 consensus 99.05
pfam00493327 MCM MCM2/3/5 family. 99.04
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 99.02
PRK11608325 pspF phage shock protein operon transcriptional activat 98.99
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 98.94
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.94
PRK09112352 DNA polymerase III subunit delta'; Validated 98.89
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 98.88
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 98.84
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 98.83
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 98.75
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 98.7
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.66
COG2204464 AtoC Response regulator containing CheY-like receiver, 98.62
COG1241682 MCM2 Predicted ATPase involved in replication control, 98.59
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.56
CHL00095 823 clpC Clp protease ATP binding subunit 98.39
PRK10865 857 protein disaggregation chaperone; Provisional 98.39
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.36
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.24
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 98.22
KOG0741744 consensus 98.21
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 98.15
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.1
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 97.9
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.89
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 97.87
KOG1968871 consensus 97.68
KOG2035351 consensus 97.3
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 96.05
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 99.26
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 97.53
KOG1051898 consensus 99.24
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 97.39
COG2425437 Uncharacterized protein containing a von Willebrand fac 94.47
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 99.17
KOG0734752 consensus 99.11
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 98.16
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.02
COG3480342 SdrC Predicted secreted protein containing a PDZ domain 99.02
KOG0743457 consensus 98.95
PHA02244383 ATPase-like protein 98.66
KOG1969 877 consensus 98.53
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.49
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 97.57
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 96.72
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 96.63
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 95.77
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.67
pfam06309127 Torsin Torsin. This family consists of several eukaryot 97.75
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 97.58
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.51
PRK13946195 shikimate kinase; Provisional 97.47
PRK09270230 frcK putative fructose transport system kinase; Reviewe 97.19
PRK06696227 uridine kinase; Validated 97.03
KOG4658 889 consensus 96.83
PRK07263453 consensus 96.34
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 96.24
PRK05636507 replicative DNA helicase; Provisional 96.03
PRK09302501 circadian clock protein KaiC; Reviewed 95.93
PRK05595444 replicative DNA helicase; Provisional 95.75
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.74
PRK04328250 hypothetical protein; Provisional 95.71
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 95.7
PRK07667190 uridine kinase; Provisional 95.65
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.62
PRK06904472 replicative DNA helicase; Validated 95.53
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 95.52
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 95.49
PRK05541176 adenylylsulfate kinase; Provisional 95.43
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 95.37
PRK13764605 ATPase; Provisional 95.33
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 95.3
PRK07004460 replicative DNA helicase; Provisional 95.25
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 95.05
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 95.04
PRK08082453 consensus 95.02
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 95.01
pfam00519432 PPV_E1_C Papillomavirus helicase. This protein is a DNA 94.99
PRK08006471 replicative DNA helicase; Provisional 94.95
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 94.89
PRK05748448 replicative DNA helicase; Provisional 94.73
PRK03846198 adenylylsulfate kinase; Provisional 94.73
PRK09165484 replicative DNA helicase; Provisional 94.72
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 94.69
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.51
PRK06067241 flagellar accessory protein FlaH; Validated 94.22
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 94.22
PRK10744257 phosphate transporter subunit; Provisional 94.21
PRK04132863 replication factor C small subunit; Provisional 98.27
KOG0732 1080 consensus 98.21
PRK08939306 primosomal protein DnaI; Reviewed 98.16
KOG0729435 consensus 98.07
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 98.07
PRK08116262 hypothetical protein; Validated 98.06
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.97
PRK13695174 putative NTPase; Provisional 97.95
PRK07952242 DNA replication protein DnaC; Validated 97.91
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.71
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.57
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.56
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 97.52
PRK12377248 putative replication protein; Provisional 97.35
PRK06835330 DNA replication protein DnaC; Validated 97.34
KOG0741744 consensus 97.33
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.1
PRK06921265 hypothetical protein; Provisional 96.97
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.78
PRK02496185 adk adenylate kinase; Provisional 96.66
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 96.5
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.44
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 96.42
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.26
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.21
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.12
PTZ00088225 adenylate kinase 1; Provisional 96.09
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.06
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.89
PRK00279215 adk adenylate kinase; Reviewed 95.83
pfam00406186 ADK Adenylate kinase. 95.63
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 95.59
PRK13808297 adenylate kinase; Provisional 95.42
COG0802149 Predicted ATPase or kinase [General function prediction 95.33
KOG2485335 consensus 95.31
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 95.28
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 95.22
smart00487201 DEXDc DEAD-like helicases superfamily. 95.14
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 94.92
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 94.8
KOG3079195 consensus 94.73
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 94.42
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 94.29
TIGR00602670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 98.14
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 97.85
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.57
COG1855604 ATPase (PilT family) [General function prediction only] 95.73
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.77
PRK04220306 2-phosphoglycerate kinase; Provisional 96.45
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.72
KOG1051 898 consensus 96.78
PRK00131175 aroK shikimate kinase; Reviewed 97.57
PRK13948182 shikimate kinase; Provisional 97.52
PRK05057172 aroK shikimate kinase I; Reviewed 97.52
PRK13947171 shikimate kinase; Provisional 97.51
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 97.46
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.45
PRK03731172 aroL shikimate kinase II; Reviewed 97.39
PRK13949169 shikimate kinase; Provisional 97.38
PRK00625173 shikimate kinase; Provisional 97.34
PRK03839180 putative kinase; Provisional 97.11
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate synthase 97.02
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 96.96
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 96.9
KOG3347176 consensus 96.81
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 96.55
PRK00300208 gmk guanylate kinase; Provisional 96.52
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.51
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 96.49
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 96.44
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.3
PRK07261171 topology modulation protein; Provisional 96.28
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 96.2
PRK04040189 adenylate kinase; Provisional 96.18
PRK08118167 topology modulation protein; Reviewed 96.18
PRK10646153 putative ATPase; Provisional 96.11
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.11
PRK00023225 cmk cytidylate kinase; Provisional 96.06
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 96.05
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 95.98
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.98
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.97
PRK09825176 idnK D-gluconate kinase; Provisional 95.94
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 95.94
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.91
PRK04182178 cytidylate kinase; Provisional 95.9
PRK11545177 gntK gluconate kinase 1; Provisional 95.87
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 95.86
COG0410237 LivF ABC-type branched-chain amino acid transport syste 95.83
pfam00625182 Guanylate_kin Guanylate kinase. 95.74
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 95.73
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 95.71
cd01394218 radB RadB. The archaeal protein radB shares similarity 95.67
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.65
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 95.6
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.6
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.51
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 95.51
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 95.5
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.49
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.49
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 95.49
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.47
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.44
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 95.43
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.43
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 95.38
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.35
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.34
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 95.33
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.28
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 95.25
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.23
PRK01184183 hypothetical protein; Provisional 95.22
pfam01202158 SKI Shikimate kinase. 95.22
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 95.19
PRK09302501 circadian clock protein KaiC; Reviewed 95.16
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.14
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.1
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 95.08
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.07
PRK05480209 uridine kinase; Provisional 95.03
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.03
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.03
PRK13768253 GTPase; Provisional 95.02
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.01
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 95.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 94.99
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 94.99
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 94.98
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 94.97
cd01124187 KaiC KaiC is a circadian clock protein primarily found 94.97
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 94.96
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.96
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 94.94
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 94.93
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.91
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 94.9
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 94.89
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 94.87
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.85
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 94.84
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.82
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 94.81
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.79
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.79
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 94.78
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 94.77
cd03234226 ABCG_White The White subfamily represents ABC transport 94.77
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.76
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.74
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.73
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 94.72
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 94.72
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 94.72
PRK13542224 consensus 94.71
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.69
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 94.69
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.68
PRK10789569 putative multidrug transporter membrane\ATP-binding com 94.67
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 94.67
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 94.65
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.65
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 94.63
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 94.62
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.58
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.56
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 94.56
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 94.56
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 94.55
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 94.55
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 94.54
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 94.53
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.51
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.51
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 94.5
PRK13544208 consensus 94.48
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 94.46
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 94.45
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 94.4
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 94.37
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 94.37
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 94.32
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 94.31
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 94.29
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 94.28
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 94.25
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.24
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 94.23
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 94.23
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 94.23
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 94.23
PRK11147632 ABC transporter ATPase component; Reviewed 94.23
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.22
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 94.19
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.16
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.14
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 94.13
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 94.12
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 94.12
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 97.44
KOG1400371 consensus 96.99
PRK10416499 cell division protein FtsY; Provisional 96.84
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 96.64
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 96.15
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 94.38
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 96.61
KOG1942456 consensus 96.45
pfam01768264 Birna_VP4 Birnavirus VP4 protein. VP4 is a viral protea 96.44
COG51921077 BMS1 GTP-binding protein required for 40S ribosome biog 95.95
KOG0964 1200 consensus 94.54
PRK06762166 hypothetical protein; Provisional 95.24
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS prot 94.12
PRK04132863 replication factor C small subunit; Provisional 94.94
PRK12337492 2-phosphoglycerate kinase; Provisional 94.74
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 94.67
KOG1803649 consensus 94.64
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 94.38
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information