HHsearch alignment for GI: 254780270 and conserved domain: COG0410

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].
Probab=95.83  E-value=0.0071  Score=40.61  Aligned_cols=39  Identities=28%  Similarity=0.481  Sum_probs=33.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
T Consensus        27 ~~Geiv~llG~NGaGKTTlLkti~Gl~~~~~G~I~~~G~   65 (237)
T COG0410          27 ERGEIVALLGRNGAGKTTLLKTIMGLVRPRSGRIIFDGE   65 (237)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCE
T ss_conf             689889998999888899999985898788706998983