HHsearch alignment for GI: 254780270 and conserved domain: COG1855

>COG1855 ATPase (PilT family) [General function prediction only].
Probab=95.73  E-value=0.013  Score=38.60  Aligned_cols=70  Identities=27%  Similarity=0.462  Sum_probs=45.8

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCHHHHHHH--HHHHHHHCHHH-HHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             9999876540415876632210688998--77665201168-99999999999984244467359986056565027999
Q gi|254780270|r  308 VRNYLDWLLGVPWDKKSKTKKNLDFAIR--ILDQDHFGLEK-VKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQ  384 (820)
Q Consensus       308 ~r~Yld~~~~lPW~~~t~~~~dl~~a~~--iLd~~hyGl~~-vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~  384 (820)
T Consensus       217 lrn~RIvIarPPfSd~----~EITavRPvvk~~ledY~L~dkl~eRL~er---------ae--GILIAG~PGaGKsTFaq  281 (604)
T COG1855         217 LRNYRIVIARPPFSDR----WEITAVRPVVKLSLEDYGLSDKLKERLEER---------AE--GILIAGAPGAGKSTFAQ  281 (604)
T ss_pred             ECCEEEEEECCCCCCC----EEEEEEEEEEEEEHHHCCCCHHHHHHHHHH---------HC--CEEEECCCCCCHHHHHH
T ss_conf             4357999945998776----289997136996055428798999998864---------16--46995699997468999


Q ss_pred             HHHHHHCC
Q ss_conf             99977088
Q gi|254780270|r  385 SIAKATGR  392 (820)
Q Consensus       385 sia~al~r  392 (820)
T Consensus       282 AlAefy~~  289 (604)
T COG1855         282 ALAEFYAS  289 (604)
T ss_pred             HHHHHHHH
T ss_conf             99999986