HHsearch alignment for GI: 254780270 and conserved domain: COG2074

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism].
Probab=96.24  E-value=0.0078  Score=40.29  Aligned_cols=42  Identities=31%  Similarity=0.449  Sum_probs=34.0

Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             999998424446735998605656502799999977088249
Q gi|254780270|r  354 YLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       354 ~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
T Consensus        77 Y~lwR~ir~~~~p~IILIGGasGVGkStIA~ElA~rLgI~~v  118 (299)
T COG2074          77 YLLWRRIRKMKRPLIILIGGASGVGKSTIAGELARRLGIRSV  118 (299)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             999999861578759996178877725799999997298610