HHsearch alignment for GI: 254780270 and conserved domain: COG2204

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].
Probab=98.62  E-value=3.3e-06  Score=65.84  Aligned_cols=184  Identities=24%  Similarity=0.430  Sum_probs=126.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCC-CCCCCC---CHHHHHHHHHCCC
Q ss_conf             446735998605656502799999977088---249986188888---888356320-014567---1289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRR-TYIGSM---PGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~-ty~ga~---pg~ii~~l~~~~~  432 (820)
T Consensus       162 ~s~a~VL-I~GESGtGKElvAr~IH~~S~R~~~PFVavNcaAip~~l~ESELFGhekGAFTGA~~~r~G~fE~A------  234 (464)
T COG2204         162 PSDASVL-ITGESGTGKELVARAIHQASPRAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQA------  234 (464)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEC------
T ss_conf             7799789-977898758999999986074458992563346489888777761456567677643457615773------


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEE--CCCCCCCCCEEEEEECC-CC-C-CC-----HHHCCCE
Q ss_conf             87399993315542311771155665540600168133201--03523644279999348-65-5-44-----1311724
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHY--LEVEYDLSDVMFIMTAN-TL-N-IP-----LPLMDRM  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y--~~~~~dls~v~fi~tan-~~-~-i~-----~~l~drm  502 (820)
T Consensus       235 ~GGTLfLDEI~~mpl~~Q----~kLLRvLq---e~~~~rvG~~~~i~v---dvRiIaaT~~dL~~~v~~G~FReDLyyRL  304 (464)
T COG2204         235 NGGTLFLDEIGEMPLELQ----VKLLRVLQ---EREFERVGGNKPIKV---DVRIIAATNRDLEEEVAAGRFREDLYYRL  304 (464)
T ss_pred             CCCEEEEECCCCCCHHHH----HHHHHHHH---CCEEEECCCCCEECE---EEEEEEECCCCHHHHHHCCCCHHHHHHHH
T ss_conf             796587323110999999----99999987---070673588860000---16999605778999988197378888652


Q ss_pred             EEEEE--CCCCH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             79982--58786-899989998608989986257813132289999999731774102347888799
Q gi|254780270|r  503 EIIRI--AGYTE-EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALM  566 (820)
Q Consensus       503 e~i~~--~~y~~-~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~  566 (820)
T Consensus       305 nV~~i~iPpLRER~EDIp~L~~hfl~~~~~~~~~--~~~~~s~~a~~~-L~~y~WPGNVREL~N~ve  368 (464)
T COG2204         305 NVVPLRLPPLRERKEDIPLLAEHFLKRFAAELGR--PPKGFSPEALAA-LLAYDWPGNVRELENVVE  368 (464)
T ss_pred             CCCEECCCCCCCCCHHHHHHHHHHHHHHHHHHCC--CCCCCCHHHHHH-HHHCCCCHHHHHHHHHHH
T ss_conf             3311048762236200799999999999998099--988879999999-973899818999999999