HHsearch alignment for GI: 254780270 and conserved domain: KOG0477

>KOG0477 consensus.
Probab=96.46  E-value=0.0067  Score=40.78  Aligned_cols=232  Identities=21%  Similarity=0.291  Sum_probs=119.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHH-HC----CCCCCCE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC--HHHHCC
Q ss_conf             652011689999999999998-42----4446735-998605656502799999977088249986188888--888356
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQM-RV----IKNKGLI-LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD--EADIRG  410 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~-~~----~~~~g~i-l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d--~~~i~g  410 (820)
T Consensus       449 PsIyGh~~VK~AvAlaLfGGv~kn~~~khkvRGDinvLL~GDPGTaKSQFLKY~eK~s~RAV~tTGqGASavGLTa~v~K  528 (854)
T KOG0477         449 PSIYGHEDVKRAVALALFGGVPKNPGGKHKVRGDINVLLLGDPGTAKSQFLKYAEKTSPRAVFTTGQGASAVGLTAYVRK  528 (854)
T ss_pred             CHHHCHHHHHHHHHHHHHCCCCCCCCCCCEECCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEEEE
T ss_conf             24314589999999998568756889874451440289846998228999999986275316850677543332688751


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCC--------
Q ss_conf             320014567128999998327887399993315542311771155665540600168133201035236442--------
Q gi|254780270|r  411 HRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSD--------  482 (820)
Q Consensus       411 h~~ty~ga~pg~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~--------  482 (820)
T Consensus       529 d---PvtrEWTLEaGALVL--ADkGvClIDEFDKMndqDRtSIHEAME------QQ----------SISISKAGIVtsLq  587 (854)
T KOG0477         529 D---PVTREWTLEAGALVL--ADKGVCLIDEFDKMNDQDRTSIHEAME------QQ----------SISISKAGIVTSLQ  587 (854)
T ss_pred             C---CCCCEEEECCCEEEE--CCCCEEEEEHHHHHCCCCCCHHHHHHH------HC----------CHHHHHHHHHHHHH
T ss_conf             7---865303651672897--268537741211204011015999987------51----------20144666899887


Q ss_pred             --EEEEEECCCC--------------CCCHHHCCCEEEEEECCCC----HHHHHH--HHHHH--HHHHHHHHHCCCCCCC
Q ss_conf             --7999934865--------------5441311724799825878----689998--99986--0898998625781313
Q gi|254780270|r  483 --VMFIMTANTL--------------NIPLPLMDRMEIIRIAGYT----EEEKLQ--IAKNH--LVKKVLTEHALKQEEC  538 (820)
Q Consensus       483 --v~fi~tan~~--------------~i~~~l~drme~i~~~~y~----~~ek~~--i~~~~--l~p~~~~~~~~~~~~~  538 (820)
T Consensus       588 ArctvIAAanPigGRY~~s~tFaqNV~ltePIlSRFDiLcVvkD~vd~~~De~lA~fVV~Sh~r~hp~~~~~~~~~e~~~  667 (854)
T KOG0477         588 ARCTVIAAANPIGGRYNPSLTFAQNVDLTEPILSRFDILCVVKDTVDPVQDEKLAKFVVGSHVRHHPSNKEEDGLEEPQM  667 (854)
T ss_pred             HHHHHHEECCCCCCCCCCCCCHHHCCCCCCCHHHHCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             55443000277777568751143305544441211132456403558136788999998767404876444676543234


Q ss_pred             C-----CCHHHHHHHHHCCCCCCHHH-HHHH----HHHHHHHHHHHHHHCCCCCEECCCHHHHHHHH
Q ss_conf             2-----28999999973177410234-7888----79999898765421178520127967867530
Q gi|254780270|r  539 C-----ISDGVLLDIIRLFTHEAGVR-SFER----ALMKIARKAVTKIVKNSDTTVSINENNLQDYL  595 (820)
Q Consensus       539 ~-----~~~~~i~~ii~~Yt~EaGvR-~l~r----~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~l  595 (820)
T Consensus       668 ~~~v~~ipq~lLrkyI~-yar~~-v~PkL~q~d~~K~s~vya~lRkES~~--tGs~piTvRHieS~i  730 (854)
T KOG0477         668 PARVEPIPQELLRKYII-YAREK-VRPKLNQMDMDKISSVYADLRKESMA--TGSLPITVRHIESMI  730 (854)
T ss_pred             CCCCCCCHHHHHHHHHH-HHHHH-CCCCCCCCCHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHH
T ss_conf             56666683999999999-99975-25001011378899999999761556--688503399999999