HHsearch alignment for GI: 254780270 and conserved domain: KOG0728

>KOG0728 consensus.
Probab=98.78  E-value=7.6e-08  Score=78.22  Aligned_cols=139  Identities=32%  Similarity=0.547  Sum_probs=96.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCE-EEEEECH
Q ss_conf             467359986056565027999999770882499861888888883563200145671289999983278873-9999331
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEI  442 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~np-v~~ldei  442 (820)
T Consensus       179 aQPKGvlLygppgtGktLlaraVahht~c~firvs------gselv---qk~igegsrmvrelfvmarehapsiifmdei  249 (404)
T KOG0728         179 AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVS------GSELV---QKYIGEGSRMVRELFVMAREHAPSIIFMDEI  249 (404)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHCCEEEEEEC------HHHHH---HHHHHHHHHHHHHHHHHHHHCCCCEEEEHHC
T ss_conf             88760488469997562999998754140799964------49999---9985013899999999987508826750000


Q ss_pred             HHHHHHC----C-CCH--HHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCC-CHHHC-----CCEEEEEECC
Q ss_conf             5542311----7-711--55665540600168133201035236442799993486554-41311-----7247998258
Q gi|254780270|r  443 DKMGSDL----R-GDP--SAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNI-PLPLM-----DRMEIIRIAG  509 (820)
Q Consensus       443 dk~~~~~----~-gdp--~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i-~~~l~-----drme~i~~~~  509 (820)
T Consensus       250 dsigs~r~e~~~ggdsevqrtmlelln--qldgfeat--------knikvimatnridild~allrpgridrk--iefp~  317 (404)
T KOG0728         250 DSIGSSRVESGSGGDSEVQRTMLELLN--QLDGFEAT--------KNIKVIMATNRIDILDPALLRPGRIDRK--IEFPP  317 (404)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCCCCC--------CCEEEEEECCCCCCCCHHHCCCCCCCCC--CCCCC
T ss_conf             121234345789863899999999997--40240003--------6626998416422246866387754555--64899


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             78689998999860
Q gi|254780270|r  510 YTEEEKLQIAKNHL  523 (820)
Q Consensus       510 y~~~ek~~i~~~~l  523 (820)
T Consensus       318 p~e~ar~~ilkihs  331 (404)
T KOG0728         318 PNEEARLDILKIHS  331 (404)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             87788878998855