HHsearch alignment for GI: 254780270 and conserved domain: KOG0741

>KOG0741 consensus.
Probab=98.21  E-value=2e-05  Score=59.91  Aligned_cols=164  Identities=27%  Similarity=0.433  Sum_probs=102.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC---------CCC
Q ss_conf             44673599860565650279999997708824998618888888835632001456712899999832---------788
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA---------KRS  433 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~---------~~~  433 (820)
T Consensus       255 HVKG--iLLyGPPGTGKTLiARqIGkMLNArePKIVN-----GPeIL~---KYVGeSE~NvR~LFaDAEeE~r~~g~~Sg  324 (744)
T KOG0741         255 HVKG--ILLYGPPGTGKTLIARQIGKMLNAREPKIVN-----GPEILN---KYVGESEENVRKLFADAEEEQRRLGANSG  324 (744)
T ss_pred             CEEE--EEEECCCCCCHHHHHHHHHHHHCCCCCCCCC-----CHHHHH---HHHCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             1235--7887799987018999987874579986347-----578898---76063078899998757999984376677


Q ss_pred             CEEEEEECHHHHHHH--C-CC-----C-HHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC--CC
Q ss_conf             739999331554231--1-77-----1-15566554060016813320103523644279999348655-441311--72
Q gi|254780270|r  434 NPLLLLDEIDKMGSD--L-RG-----D-PSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM--DR  501 (820)
Q Consensus       434 npv~~ldeidk~~~~--~-~g-----d-p~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~--dr  501 (820)
T Consensus       325 LHIIIFDEiDAICKqRGS~~g~TGVhD~VVNQLLsKmDG------------V-eqLNNILVIGMTNR~DlIDEALLRPGR  391 (744)
T KOG0741         325 LHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKMDG------------V-EQLNNILVIGMTNRKDLIDEALLRPGR  391 (744)
T ss_pred             CEEEEEHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCC------------H-HHHHCEEEEECCCCHHHHHHHHCCCCC
T ss_conf             259996346799974488789886318999999985322------------8-766167899404736667887558871


Q ss_pred             EEE-EEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             479-9825878689998999860898998625781313228999999973177
Q gi|254780270|r  502 MEI-IRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFT  553 (820)
Q Consensus       502 me~-i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt  553 (820)
T Consensus       392 lEVqmEIsLPDE~gRlQIl~IH--T~rMre~~~l~~dVdl~e--lA~lTKNfS  440 (744)
T KOG0741         392 LEVQMEISLPDEKGRLQILKIH--TKRMRENNKLSADVDLKE--LAALTKNFS  440 (744)
T ss_pred             EEEEEEEECCCCCCCEEEEEHH--HHHHHHCCCCCCCCCHHH--HHHHHCCCC
T ss_conf             6999998468876727888714--455665178777769899--999855786