HHsearch alignment for GI: 254780270 and conserved domain: KOG1051

>KOG1051 consensus.
Probab=99.24  E-value=4.2e-09  Score=87.75  Aligned_cols=164  Identities=26%  Similarity=0.451  Sum_probs=120.9

Q ss_pred             CCCCCCCC-CCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCC-CC---CCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             04158766-32210688998776652011689999999999998424-44---673599860565650279999997708
Q gi|254780270|r  317 GVPWDKKS-KTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVI-KN---KGLILCFVGPPGVGKTSLAQSIAKATG  391 (820)
Q Consensus       317 ~lPW~~~t-~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~~-~~---~g~il~l~gppgvGKts~~~sia~al~  391 (820)
T Consensus       539 gip~~~~~~~e~~~l~~L~~~L~~~V~gQ~eAv~aIa~A--I~~sr~gl~~~~~~awflflGpdgvGKt~lAkaLA~~~F  616 (898)
T KOG1051         539 GIPVDRLAEAEAERLKKLEERLHERVIGQDEAVAAIAAA--IRRSRAGLKDPNPDAWFLFLGPDGVGKTELAKALAEYVF  616 (898)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH--HHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             782144316678999999999975446637789999999--984320357888885899978884138999999999972


Q ss_pred             ---CCEEEEECCCCCCHHHHCCCCCCCCCCCCH-HHHHHHHHCCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCC
Q ss_conf             ---824998618888888835632001456712-8999998327887399993315542311771155665540600168
Q gi|254780270|r  392 ---RQYVRMSLGGVYDEADIRGHRRTYIGSMPG-RIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNS  467 (820)
Q Consensus       392 ---r~f~~islgg~~d~~~i~gh~~ty~ga~pg-~ii~~l~~~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~  467 (820)
T Consensus       617 gse~~~IriDmse~~evskligsp~gyvG~e~gg~Lteavrr--rP~sVvLfdeIEkAh~----~v~n~llq~lD~---G  687 (898)
T KOG1051         617 GSEENFIRLDMSEFQEVSKLIGSPPGYVGKEEGGQLTEAVKR--RPYSVVLFEEIEKAHP----DVLNILLQLLDR---G  687 (898)
T ss_pred             CCCCCEEEECHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHC--CCCEEEEEECHHHCCH----HHHHHHHHHHHC---C
T ss_conf             886426896145555565304899555463057788899716--9965999830222288----899999999862---7


Q ss_pred             CEEEEECCCCCCCCCEEEEEECCCC
Q ss_conf             1332010352364427999934865
Q gi|254780270|r  468 SFVDHYLEVEYDLSDVMFIMTANTL  492 (820)
Q Consensus       468 ~f~d~y~~~~~dls~v~fi~tan~~  492 (820)
T Consensus       688 rltDs~-Gr~Vd~kN~I~IMTsn~~  711 (898)
T KOG1051         688 RLTDSH-GREVDFKNAIFIMTSNVG  711 (898)
T ss_pred             CCCCCC-CCEEECCCEEEEEECCCC
T ss_conf             400588-867504645999942631