HHsearch alignment for GI: 254780270 and conserved domain: KOG1803

>KOG1803 consensus.
Probab=94.64  E-value=0.036  Score=35.24  Aligned_cols=140  Identities=16%  Similarity=0.281  Sum_probs=66.2

Q ss_pred             CEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHH
Q ss_conf             27999934865544131172479982587868999899986089899862578131322899999997317741023478
Q gi|254780270|r  482 DVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSF  561 (820)
Q Consensus       482 ~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l  561 (820)
T Consensus       477 PlvlvDT~~~~~----~e~~~e~~~~~S~~N~gEa~Iv~~Hv--~~L~~~gV~p~dIa--------VIsPY~aQ--v~--  538 (649)
T KOG1803         477 PLVLVDTQGEKD----EEKRGEEEELGSKYNEGEAKIVMEHV--KRLLEAGVQPSDIA--------VISPYNAQ--VS--  538 (649)
T ss_pred             CEEEEECCCCHH----HHHCCCHHHCCCCCCHHHHHHHHHHH--HHHHHCCCCHHHEE--------EECCCHHH--HH--
T ss_conf             679996566054----44042033324547778899999999--99998499856737--------86551688--88--


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC----CCCCCHHCCCCCCCCCEEEECCCCCEEEEEEEEEECCC
Q ss_conf             88799998987654211785201279678675305200----03320002233650000000001680799999997489
Q gi|254780270|r  562 ERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR----YKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMPGK  637 (820)
Q Consensus       562 ~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~----~~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE~~~~~g~  637 (820)
T Consensus       539 ------llR------~~~~~~~~~veV~TVD~fQGrEkdvVIfsmVRSN~k~evGFL---------~e~RRLNVAiTRaR  597 (649)
T KOG1803         539 ------LLR------EEDEEDFRDVEVGTVDGFQGREKDVVIFSLVRSNDKGEVGFL---------GETRRLNVAITRAR  597 (649)
T ss_pred             ------HHH------HCCCCCCCCCEEECCCCCCCCEEEEEEEEEEEECCCCCCCCC---------CCCCEEEEEEEECC
T ss_conf             ------875------303566766346021253552101899999963676544434---------77643567887324


Q ss_pred             CCEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             972443256899999999999999
Q gi|254780270|r  638 GEITITGNLKEIMKESILAASSYV  661 (820)
Q Consensus       638 g~l~lTG~lg~vmkES~~~A~s~~  661 (820)
T Consensus       598 Rh~~vIgd-s~tl~~~~~~l~k~~  620 (649)
T KOG1803         598 RHFVVIGD-SRTLKEGNEFLKKLV  620 (649)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHHH
T ss_conf             13899818-088876689999999