HHsearch alignment for GI: 254780270 and conserved domain: KOG2227

>KOG2227 consensus.
Probab=97.94  E-value=0.00084  Score=47.61  Aligned_cols=210  Identities=20%  Similarity=0.309  Sum_probs=112.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCCC--CHHH-----------HCCCCCCCCCCCCHHHHHHH
Q ss_conf             467359986056565027999999770---8824998618888--8888-----------35632001456712899999
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKAT---GRQYVRMSLGGVY--DEAD-----------IRGHRRTYIGSMPGRIIQSL  427 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al---~r~f~~islgg~~--d~~~-----------i~gh~~ty~ga~pg~ii~~l  427 (820)
T Consensus       173 ~t~gSlYVsG~PGtgkt~~l~rvl~~~~~~~~~~~~v~inc~sl~~~~aiF~kI~~~~~q~~~s~~~------~--~~~~  244 (529)
T KOG2227         173 NTSGSLYVSGQPGTGKTALLSRVLDSLSKSSKSPVTVYINCTSLTEASAIFKKIFSSLLQDLVSPGT------G--MQHL  244 (529)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCH------H--HHHH
T ss_conf             6676457517998654889999987403431665169985123542588999998889887428950------4--7899


Q ss_pred             HH-----CCCCCE-EEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHH----
Q ss_conf             83-----278873-99993315542311771155665540600168133201035236442799993486554413----
Q gi|254780270|r  428 KR-----AKRSNP-LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLP----  497 (820)
Q Consensus       428 ~~-----~~~~np-v~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~----  497 (820)
T Consensus       245 ~~~~~h~~q~k~~~llVlDEmD~L~tr~~~----vLy~lFe------w------p~lp~sr~iLiGiANslDlTdR~Lpr  308 (529)
T KOG2227         245 EKFEKHTKQSKFMLLLVLDEMDHLITRSQT----VLYTLFE------W------PKLPNSRIILIGIANSLDLTDRFLPR  308 (529)
T ss_pred             HHHHHHHHCCCCEEEEEECHHHHHHHCCCC----EEEEEHH------C------CCCCCCEEEEEEEHHHHHHHHHHHHH
T ss_conf             999998752563389872125677604653----1432100------1------36776605666400135577777666


Q ss_pred             HCCCE----EEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             11724----79982587868999899986089899862578131322899999997317741023478887999989876
Q gi|254780270|r  498 LMDRM----EIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAV  573 (820)
Q Consensus       498 l~drm----e~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~  573 (820)
T Consensus       309 L~~~~~~~P~~l~F~PYTk~qI~~Il~~rl~---------~~~t~~~~~~Aie~~ArKvaa~SG--Dl-RkaLdv~R~-a  375 (529)
T KOG2227         309 LNLDLTIKPKLLVFPPYTKDQIVEILQQRLS---------EESTSIFLNAAIELCARKVAAPSG--DL-RKALDVCRR-A  375 (529)
T ss_pred             HHHCCCCCCCEEEECCCCHHHHHHHHHHHHH---------CCCCCCCCHHHHHHHHHHHCCCCH--HH-HHHHHHHHH-H
T ss_conf             5402578874665568788999999999974---------054433303899999998625761--28-999999987-8


Q ss_pred             HHHHCCCCCEECCCHHHHHHHHCCCCCCCCCHHCC-CCCCCCCEEEECC
Q ss_conf             54211785201279678675305200033200022-3365000000000
Q gi|254780270|r  574 TKIVKNSDTTVSINENNLQDYLGVPRYKYGKIEGE-DQVGIVTGLAWTE  621 (820)
Q Consensus       574 ~~~~~~~~~~~~i~~~~l~~~lg~~~~~~~~~~~~-~~~G~v~GLa~t~  621 (820)
T Consensus       376 iEI~E~e~r~~~------~~----~l-~~~~~p~~~~~v~~~~va~viS  413 (529)
T KOG2227         376 IEIAEIEKRKIL------DD----PL-SPGTSPEKKKKVGVEHVAAVIS  413 (529)
T ss_pred             HHHHHHHHHHCC------CC----CC-CCCCCCCCCCCCCHHHHHHHHH
T ss_conf             899999874134------46----78-8888855455500678998840