HHsearch alignment for GI: 254780270 and conserved domain: KOG2680

>KOG2680 consensus.
Probab=98.13  E-value=2.2e-05  Score=59.54  Aligned_cols=203  Identities=29%  Similarity=0.442  Sum_probs=117.3

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--CEEEEECCC---------------------CC--CHHH-HCCCC-
Q ss_conf             424446735998605656502799999977088--249986188---------------------88--8888-35632-
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIAKATGR--QYVRMSLGG---------------------VY--DEAD-IRGHR-  412 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia~al~r--~f~~islgg---------------------~~--d~~~-i~gh~-  412 (820)
T Consensus        60 ~egkiaGraiLiaG~pgtGKtAiAmg~sksLG~~tpF~~i~gSEI~SlEmsKTEAltQAfRksiGvrIKEetevIEGEVV  139 (454)
T KOG2680          60 REGKIAGRAILIAGQPGTGKTAIAMGMSKSLGDDTPFTSISGSEIYSLEMSKTEALTQAFRKSIGVRIKEETEVIEGEVV  139 (454)
T ss_pred             HCCCCCCEEEEEECCCCCCCEEEEEEHHHHHCCCCCEEEEECCEEEEECCCHHHHHHHHHHHHHCEEEEHEEEEECCEEE
T ss_conf             72863213899724898884410000245407887503650222221000177999999888516474000014300589


Q ss_pred             -------CCCCCCCC-----------------HHHHHHHHHCCCCC-EEEEEEC----HHHHHHHCCC----CHH-----
Q ss_conf             -------00145671-----------------28999998327887-3999933----1554231177----115-----
Q gi|254780270|r  413 -------RTYIGSMP-----------------GRIIQSLKRAKRSN-PLLLLDE----IDKMGSDLRG----DPS-----  454 (820)
Q Consensus       413 -------~ty~ga~p-----------------g~ii~~l~~~~~~n-pv~~lde----idk~~~~~~g----dp~-----  454 (820)
T Consensus       140 eiqidRp~tg~g~k~GKlt~kTtdMEt~ydlG~Kmi~~l~KeKV~aGDVI~idka~GkitKlGrSf~rsrdyDamG~~tk  219 (454)
T KOG2680         140 EIQIDRPATGMGSKVGKLTLKTTDMETIYDLGMKMIESLTKEKVQAGDVITIDKASGKITKLGRSFTRSRDYDAMGSQTK  219 (454)
T ss_pred             EEEEECCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEHHHCCCCCCCCCCCCCCCCC
T ss_conf             99960466676764444677521115588788999877657533678559987024630021012010346776577651


Q ss_pred             ------HHH-------------------------------------HHHCCCCC----------------CCCEEE--EE
Q ss_conf             ------566-------------------------------------55406001----------------681332--01
Q gi|254780270|r  455 ------AAL-------------------------------------LEVLDPAQ----------------NSSFVD--HY  473 (820)
Q Consensus       455 ------~al-------------------------------------levldp~q----------------n~~f~d--~y  473 (820)
T Consensus       220 fVqCPeGElqkrkevvhtvsLHeIDViNSrtqG~lALFsGdTGEIr~EvRdqin~KV~eWreEGKAeivpGVLFIDEvHM  299 (454)
T KOG2680         220 FVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEVRDQINTKVAEWREEGKAEIVPGVLFIDEVHM  299 (454)
T ss_pred             EECCCCHHHHHEEEEEEEEEECCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCEEEEEEEHH
T ss_conf             42399314410023357643000133455665248997078652018889888788898886177242255178740021


Q ss_pred             CC----------CCCCCCCEEEEEEC---------CCC--C-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             03----------52364427999934---------865--5-44131172479982587868999899986089899862
Q gi|254780270|r  474 LE----------VEYDLSDVMFIMTA---------NTL--N-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEH  531 (820)
Q Consensus       474 ~~----------~~~dls~v~fi~ta---------n~~--~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~  531 (820)
T Consensus       300 LDIEcFsFlNrAlE~d~~PiiimaTNrgit~iRGTn~~SphGiP~D~lDR~lII~t~py~~~d~~~IL~i----------  369 (454)
T KOG2680         300 LDIECFSFLNRALENDMAPIIIMATNRGITRIRGTNYRSPHGIPIDLLDRMLIISTQPYTEEDIKKILRI----------  369 (454)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEECCCCCCCCCCCHHHHHHHHEEECCCCCHHHHHHHHHH----------
T ss_conf             1157999888876504685799972775577605777898888677764412552565768899999875----------


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCCHHHH---HHHHHHHHHHHHH
Q ss_conf             57813132289999999731774102347---8887999989876
Q gi|254780270|r  532 ALKQEECCISDGVLLDIIRLFTHEAGVRS---FERALMKIARKAV  573 (820)
Q Consensus       532 ~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~---l~r~i~~i~r~~~  573 (820)
T Consensus       370 Rc~EEdv~m~~~A~d~Lt~i-~~~tsLRYai~Lit~a~~~~~krk  413 (454)
T KOG2680         370 RCQEEDVEMNPDALDLLTKI-GEATSLRYAIHLITAASLVCLKRK  413 (454)
T ss_pred             HHHHHCCCCCHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             50052133587899999986-131237899999889999998754