HHsearch alignment for GI: 254780270 and conserved domain: KOG3347

>KOG3347 consensus.
Probab=96.81  E-value=0.0011  Score=46.60  Aligned_cols=36  Identities=33%  Similarity=0.650  Sum_probs=30.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             446735998605656502799999977088249986
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~~is  398 (820)
T Consensus         4 ~r~~PNILvtGTPG~GKstl~~~lae~~~~~~i~is   39 (176)
T KOG3347           4 ERERPNILVTGTPGTGKSTLAERLAEKTGLEYIEIS   39 (176)
T ss_pred             HHCCCCEEEECCCCCCCHHHHHHHHHHHCCCEEEHH
T ss_conf             113788798679998802599999997398567455