HHsearch alignment for GI: 254780270 and conserved domain: PRK00300

>PRK00300 gmk guanylate kinase; Provisional.
Probab=96.52  E-value=0.0034  Score=43.04  Aligned_cols=33  Identities=21%  Similarity=0.544  Sum_probs=26.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             446735998605656502799999977088249
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
T Consensus         4 ~~~g~livisGPSG~GK~tl~~~L~~~~p~~~~   36 (208)
T PRK00300          4 MRRGLLIVLSAPSGAGKSTLVRALLERDPNDLQ   36 (208)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             418838999999988999999999972998689