HHsearch alignment for GI: 254780270 and conserved domain: PRK00771

>PRK00771 signal recognition particle protein Srp54; Provisional.
Probab=96.38  E-value=0.1  Score=31.89  Aligned_cols=106  Identities=25%  Similarity=0.334  Sum_probs=66.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC-CCEEEEEE
Q ss_conf             44467359986056565027999999770882499861888888883563200145671289999983278-87399993
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR-SNPLLLLD  440 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~-~npv~~ld  440 (820)
T Consensus        93 ~~~kP~Vim~vGlqGsGKTTT~aKLA~~~kk~g~kv~lvaa-D---------t~R---paA~eQL~~la~~~~v~~~---  156 (433)
T PRK00771         93 ILLKPQTILLVGLQGSGKTTTAAKLARYFQKKGLKVGVICA-D---------TWR---PGAYEQLKQLCEKINVPFY---  156 (433)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC-C---------CCC---HHHHHHHHHHHHHCCCCCC---
T ss_conf             66898589997378897899999999999977994678506-7---------883---6899999999986388731---


Q ss_pred             CHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCE
Q ss_conf             31554231177115566554060016813320103523644279999348655441311724
Q gi|254780270|r  441 EIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRM  502 (820)
Q Consensus       441 eidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drm  502 (820)
T Consensus       157 -----~~~~~~dp~~i~~~a~~-----~~k~------~---DvviiDTAGRl~~d~~Lm~El  199 (433)
T PRK00771        157 -----GDPKEKDAVKIVKEGLE-----KLKK------V---DVIIVDTAGRHKLEKDLIEEM  199 (433)
T ss_pred             -----CCCCCCCHHHHHHHHHH-----HHCC------C---CEEEEECCCCCCCCHHHHHHH
T ss_conf             -----78899999999999999-----8456------9---889997765210409999999