HHsearch alignment for GI: 254780270 and conserved domain: PRK04040

>PRK04040 adenylate kinase; Provisional.
Probab=96.18  E-value=0.011  Score=39.17  Aligned_cols=44  Identities=25%  Similarity=0.427  Sum_probs=33.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECC-----------CCCCHHHHC
Q ss_conf             73599860565650279999997708824998618-----------888888835
Q gi|254780270|r  366 GLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLG-----------GVYDEADIR  409 (820)
Q Consensus       366 g~il~l~gppgvGKts~~~sia~al~r~f~~islg-----------g~~d~~~i~  409 (820)
T Consensus         2 ~k~VvvtGiPGvGKTTv~~~~~~~l~~~~~~vn~G~~M~e~A~~~glv~~RDemR   56 (189)
T PRK04040          2 MKVVVVTGVPGVGKTTVLNKALEKLKEDYKIVNFGDVMLEVAKEEGLVEHRDEMR   56 (189)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHCCCCCCHHHHC
T ss_conf             4189997589887899999999972358759867799999999817734778874