HHsearch alignment for GI: 254780270 and conserved domain: PRK04132

>PRK04132 replication factor C small subunit; Provisional.
Probab=98.27  E-value=1.1e-06  Score=69.30  Aligned_cols=98  Identities=17%  Similarity=0.215  Sum_probs=69.0

Q ss_pred             CCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             44279999348655-44131172479982587868999899986089899862578131322899999997317741023
Q gi|254780270|r  480 LSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGV  558 (820)
Q Consensus       480 ls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGv  558 (820)
T Consensus       673 ~~~~~~~~SCNYsSKIIePIQSRCavFRF~PL~~e~v~~--------RL-~~I-a~~Egv~itedGleAI~~--~aeGDM  740 (863)
T PRK04132        673 IANGFVSHNCNYSSKIIEPIQSRCAIFRFRPLRDEDIAK--------RL-RYI-AENEGLELTEEGLQAILY--VAEGDM  740 (863)
T ss_pred             HCCCEEEEECCCCCCCCCHHHCCEEEEEECCCCHHHHHH--------HH-HHH-HHHCCCCCCHHHHHHHHH--HCCCCH
T ss_conf             205617986676040741665562478836899999999--------99-999-997499767789999999--756748


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCCC
Q ss_conf             478887999989876542117852012796786753052000
Q gi|254780270|r  559 RSFERALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPRY  600 (820)
Q Consensus       559 R~l~r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~~  600 (820)
T Consensus       741 Rk---AIN~LQsaa~--------~~~~Vt~d~Vy~v~~~p~P  771 (863)
T PRK04132        741 RR---AINVLQAAAA--------LDTKITDENVFKVASRARP  771 (863)
T ss_pred             HH---HHHHHHHHHH--------CCCCCCHHHHHHHCCCCCH
T ss_conf             99---9999999986--------1698788899997089998