HHsearch alignment for GI: 254780270 and conserved domain: PRK04195

>PRK04195 replication factor C large subunit; Provisional.
Probab=99.64  E-value=4.1e-14  Score=125.69  Aligned_cols=189  Identities=25%  Similarity=0.382  Sum_probs=129.8

Q ss_pred             CCCC-CCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC-CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             4158-7663221068899877665201168999999999999842-4446735998605656502799999977088249
Q gi|254780270|r  318 VPWD-KKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV-IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       318 lPW~-~~t~~~~dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~-~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
T Consensus         2 ~~WveKYRPk~~----------~divg~~~~v~~l~~Wl--~~w~~g~~~~k~lLL~GPpGvGKTT~a~~lAk~~g~~vi   69 (403)
T PRK04195          2 MPWVEKYRPKSL----------SDVVGNEKAKKQLREWI--ESWLKGKPPKKALLLYGPPGVGKTSLAHALANDYGWEVI   69 (403)
T ss_pred             CCCCCCCCCCCH----------HHHHCCHHHHHHHHHHH--HHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             986402189989----------99858899999999999--998739965746998893998799999999998499859


Q ss_pred             EEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHC----CCCCEEEEEECHHHHHHHCCCCH--HHHHHHHCCCCCCCCE
Q ss_conf             98618888888835632001456712899999832----78873999933155423117711--5566554060016813
Q gi|254780270|r  396 RMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRA----KRSNPLLLLDEIDKMGSDLRGDP--SAALLEVLDPAQNSSF  469 (820)
Q Consensus       396 ~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~----~~~npv~~ldeidk~~~~~~gdp--~~allevldp~qn~~f  469 (820)
T Consensus        70 ElNASD~R~~~~I~~------------~i~~~~~~~sl~~~~~KlIIlDEvD~l~~~--~d~gg~~al~~~ik~------  129 (403)
T PRK04195         70 ELNASDQRTKDVIER------------VAGEASTSGSLFGAKRKLILLDEVDGIHGN--ADRGGVRAILEIIKK------  129 (403)
T ss_pred             EECCCCCCCHHHHHH------------HHHHHHHCCCCCCCCCEEEEEECCCCCCCH--HHHHHHHHHHHHHHC------
T ss_conf             977101147899999------------999876068877887349996343445724--447999999999854------


Q ss_pred             EEEECCCCCCCCCEEEEEECCCC-C-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             32010352364427999934865-5-441311724799825878689998999860898998625781313228999999
Q gi|254780270|r  470 VDHYLEVEYDLSDVMFIMTANTL-N-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLD  547 (820)
Q Consensus       470 ~d~y~~~~~dls~v~fi~tan~~-~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~  547 (820)
T Consensus       130 -----------s~~PiIli~Nd~~~~~~~~lrs~c~~i~F~~~~~~~I~~~L-----~~I~~-----~Egi~i~~~aL~~  188 (403)
T PRK04195        130 -----------AKNPIILTANDPYDPSLRPLRNACLMIEFKRLSKRSIVPVL-----KRICR-----KEGIECEEEALRE  188 (403)
T ss_pred             -----------CCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHH-----HHHHH-----HCCCCCCHHHHHH
T ss_conf             -----------88708998268455671779976612217994999999999-----99999-----7699999999999


Q ss_pred             HHHCCCCCCHHHHH
Q ss_conf             97317741023478
Q gi|254780270|r  548 IIRLFTHEAGVRSF  561 (820)
Q Consensus       548 ii~~Yt~EaGvR~l  561 (820)
T Consensus       189 Ia~~--s~GDlR~a  200 (403)
T PRK04195        189 IAER--SGGDLRSA  200 (403)
T ss_pred             HHHH--CCCHHHHH
T ss_conf             9998--79739999