HHsearch alignment for GI: 254780270 and conserved domain: PRK04328

>PRK04328 hypothetical protein; Provisional.
Probab=95.71  E-value=0.017  Score=37.77  Aligned_cols=38  Identities=18%  Similarity=0.275  Sum_probs=28.6

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHH-HHHHHC--CCEEEEEC
Q ss_conf             444673599860565650279999-997708--82499861
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQS-IAKATG--RQYVRMSL  399 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~s-ia~al~--r~f~~isl  399 (820)
T Consensus        20 Glp~gs~~Lv~G~pGtGKT~la~qFl~~g~~~GE~~lyis~   60 (250)
T PRK04328         20 GIPERNVVLLSGGPGTGKSIFSQQFLWNGLQMGEPGIYVAL   60 (250)
T ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             98799699998289999899999999999876997799997