HHsearch alignment for GI: 254780270 and conserved domain: PRK05201

>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional.
Probab=99.63  E-value=1.5e-13  Score=121.36  Aligned_cols=262  Identities=23%  Similarity=0.350  Sum_probs=175.5

Q ss_pred             HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHC------C----CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             068899877665201168999999999999842------4----446735998605656502799999977088249986
Q gi|254780270|r  329 NLDFAIRILDQDHFGLEKVKERIIEYLAVQMRV------I----KNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMS  398 (820)
Q Consensus       329 dl~~a~~iLd~~hyGl~~vK~rile~lav~~~~------~----~~~g~il~l~gppgvGKts~~~sia~al~r~f~~is  398 (820)
T Consensus         5 tP~eIv~~LD~yIIGQ~~AKkavA--VAlrNr~RR~~l~~~lr~Ei~pkNILmIGPTGvGKTeIARrLAkl~~aPFvkve   82 (442)
T PRK05201          5 TPREIVSELDKYIIGQDDAKRAVA--IALRNRWRRMQLPEELRDEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVE   82 (442)
T ss_pred             CHHHHHHHHCCCCCCCHHHHHHHH--HHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             989999985360108277667877--788777875316622123346431688788886678999999998489858752


Q ss_pred             ------CCCCCCH--HHHC-------------------------------------------------CCCCC-------
Q ss_conf             ------1888888--8835-------------------------------------------------63200-------
Q gi|254780270|r  399 ------LGGVYDE--ADIR-------------------------------------------------GHRRT-------  414 (820)
Q Consensus       399 ------lgg~~d~--~~i~-------------------------------------------------gh~~t-------  414 (820)
T Consensus        83 ATk~TEvGYvGrDVEsiIrdLv~~a~~~~k~~~~~~v~~~A~~~a~~ril~~L~~~~~~~~~~~~~~~~~~~tre~~r~~  162 (442)
T PRK05201         83 ATKFTEVGYVGRDVESIIRDLVEIAVKMVREEKREKVREKAEEAAEERILDALLPPAKNNWGEEEEEEESSATRQKFRKK  162 (442)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             13100034356437889999999999999999999999999999999999985586555555545420236789999999


Q ss_pred             ---------------------------------------CCCCCCHH----------------------------HH-HH
Q ss_conf             ---------------------------------------14567128----------------------------99-99
Q gi|254780270|r  415 ---------------------------------------YIGSMPGR----------------------------II-QS  426 (820)
Q Consensus       415 ---------------------------------------y~ga~pg~----------------------------ii-~~  426 (820)
T Consensus       163 Lr~G~Ldd~~IeIev~~~~~~~~~~~~g~~~~~~~l~~~~~~~~~~~~kkr~~tVkeA~~iL~~eEa~klid~d~v~~eA  242 (442)
T PRK05201        163 LREGELDDKEIEIEVADAPGVEIMGPPGMEEMGNQLQDMFGNLGPKKKKKRKLKVKEARKLLIEEEAAKLVDQEEIKQEA  242 (442)
T ss_pred             HHCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             86588665557886157777777788751556667998764027888740464699999999999998624889999999


Q ss_pred             HHHCCCCCEEEEEECHHHHHHH---CCCCHHH-----HHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECC--C---CC
Q ss_conf             9832788739999331554231---1771155-----66554060016813320103523644279999348--6---55
Q gi|254780270|r  427 LKRAKRSNPLLLLDEIDKMGSD---LRGDPSA-----ALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTAN--T---LN  493 (820)
Q Consensus       427 l~~~~~~npv~~ldeidk~~~~---~~gdp~~-----allevldp~qn~~f~d~y~~~~~dls~v~fi~tan--~---~~  493 (820)
T Consensus       243 i~~aE-q~GIVFIDEIDKIa~~~~~~g~DVS~EGVQrdLLpivEGt~V~---tK~G--~V~TdhILFIasGAFh~sKPSD  316 (442)
T PRK05201        243 IERVE-QNGIVFIDEIDKIAKRGEGSGPDVSREGVQRDLLPLVEGSTVS---TKYG--MVKTDHILFIASGAFHVAKPSD  316 (442)
T ss_pred             HHHHH-HCCCEEECHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCC---CCCC--CCCCCEEEEECCCCCCCCCCCH
T ss_conf             99887-6170451146565303578898977330788878875388555---6777--6025503455045001478202


Q ss_pred             -CCHHHCCCEEE-EEECCCCHHHHHHHH---HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC------CCCCHHHHHH
Q ss_conf             -44131172479-982587868999899---986089899862578131322899999997317------7410234788
Q gi|254780270|r  494 -IPLPLMDRMEI-IRIAGYTEEEKLQIA---KNHLVKKVLTEHALKQEECCISDGVLLDIIRLF------THEAGVRSFE  562 (820)
Q Consensus       494 -i~~~l~drme~-i~~~~y~~~ek~~i~---~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Y------t~EaGvR~l~  562 (820)
T Consensus       317 LIPE-l~GRlPv~v~L~~L~~~dl~~ILtepknsL~kQy~~Lf~~egv~L~Ft~~Al~~IA~~A~~~n~~~~~iGAR~L~  395 (442)
T PRK05201        317 LIPE-LQGRFPIRVELDALTEEDFVRILTEPKASLIKQYQALLATEGVTLEFTDDAIRRIAEIAYQVNEKTENIGARRLH  395 (442)
T ss_pred             HHHH-HCCCCEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             2498-717550588824499999999967861578999999986249679984799999999999851447667737889


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCCCC
Q ss_conf             8799998987654211785201279678675305200
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGVPR  599 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~~~  599 (820)
T Consensus       396 tI~E~vl~d~~Fe~p~~~~~~v~I~~~~V~~~l~~i~  432 (442)
T PRK05201        396 TVMEKLLEDISFEAPDRSGEKITIDAAYVDEKLGDLV  432 (442)
T ss_pred             HHHHHHHHHHCCCCCCCCCCEEEECHHHHHHHHHHHH
T ss_conf             9999998986146889999779988999999998876