HHsearch alignment for GI: 254780270 and conserved domain: PRK05564

>PRK05564 DNA polymerase III subunit delta'; Validated.
Probab=98.97  E-value=2.3e-08  Score=82.11  Aligned_cols=143  Identities=20%  Similarity=0.300  Sum_probs=97.3

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCC-CCC
Q ss_conf             6520116899999999999984244467359986056565027999999770882499861888888883563200-145
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRT-YIG  417 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~t-y~g  417 (820)
T Consensus         4 ~~iiGq~~i~~~L~~~i-----~~~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll~~~------~~------~~~~D~~~~~   66 (313)
T PRK05564          4 RTIIGHENIKNRIDNSI-----IKGKFSHASLIVGEDGIGKSILAKEIANKILGKS------EQ------REYVDIIEYK   66 (313)
T ss_pred             HHCCCHHHHHHHHHHHH-----HCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCC------CC------CCCCCEEEEE
T ss_conf             23268299999999999-----8799875043279998509999999999982899------77------8898658863


Q ss_pred             CCCHH---------HHHHHHHC--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEE
Q ss_conf             67128---------99999832--78873999933155423117711556655406001681332010352364427999
Q gi|254780270|r  418 SMPGR---------IIQSLKRA--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFI  486 (820)
Q Consensus       418 a~pg~---------ii~~l~~~--~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi  486 (820)
T Consensus        67 ~~~~~~I~vd~IR~l~~~~~~~p~~g~~KV~II~~ae~m~~~----AaNALLKtL-------------EEPP--~~t~fI  127 (313)
T PRK05564         67 PINKKSIGVDDIRNIIEEVNKKPYEGDKKVIIIYKSEKMTEQ----AQNAFLKTI-------------EEPP--KGVFII  127 (313)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHCHH----HHHHHHHCC-------------CCCC--CCEEEE
T ss_conf             322569998999999999840862589569998077775899----999984550-------------3689--985899


Q ss_pred             EECCCCC-CCHHHCCCEEEEEECCCCHHHHHH
Q ss_conf             9348655-441311724799825878689998
Q gi|254780270|r  487 MTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       487 ~tan~~~-i~~~l~drme~i~~~~y~~~ek~~  517 (820)
T Consensus       128 L~t~~~~~lLpTI~SRCQ~~~f~~l~~~~i~~  159 (313)
T PRK05564        128 LLCENLEQILDTIKSRCQIYKLNRLSKEDIEK  159 (313)
T ss_pred             EEECCHHHCCCHHHCCCEEEECCCCCHHHHHH
T ss_conf             86498354757787065356689989999999