HHsearch alignment for GI: 254780270 and conserved domain: PRK05818

>PRK05818 DNA polymerase III subunit delta'; Validated.
Probab=97.31  E-value=0.0018  Score=45.04  Aligned_cols=173  Identities=14%  Similarity=0.110  Sum_probs=102.0

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCC-----------CEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHH----
Q ss_conf             46735998605656502799999977088-----------249986188888888356320014567128999998----
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGR-----------QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLK----  428 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r-----------~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~----  428 (820)
T Consensus         6 n~~halLl~~~~G~~~~~~~~~~~k~LlC~~~~~PCG~C~sC~~i~~g~HPD~~~i~p----e~~sIkieqir~li~~l~   81 (262)
T PRK05818          6 NKTHPLLLIERKGSFLKPFLYEYLTSIVCTKANGFCKTCESCLKILNGKYNDFYLIFD----QKNPIKKEDALSIINKLN   81 (262)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCCEEEEEC----CCCCCCHHHHHHHHHHHH
T ss_conf             8985056644877646999999999862289999998886278675589997799716----645577989999999982


Q ss_pred             HCC-C--CCEEEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCEEEEEECCCC-CCCHHHCCCEE
Q ss_conf             327-8--87399993315542311771155665540-6001681332010352364427999934865-54413117247
Q gi|254780270|r  429 RAK-R--SNPLLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEYDLSDVMFIMTANTL-NIPLPLMDRME  503 (820)
Q Consensus       429 ~~~-~--~npv~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~dls~v~fi~tan~~-~i~~~l~drme  503 (820)
T Consensus        82 ~~s~e~~g~KV~II~~Ae~Mt~~----AANALLKtLEEPp~----------------nt~fIL~t~~~~~LLPTIrSRC~  141 (262)
T PRK05818         82 RPSVESNGKKIYIIYGIEKLNKQ----SANSLLKLIEEPPK----------------NTYGIFTTRNENNILNTILSRCV  141 (262)
T ss_pred             HCCCCCCCCEEEEECCHHHHCHH----HHHHHHHHHCCCCC----------------CEEEEEEECCHHHCCCHHHHHCC
T ss_conf             11400288489998777874999----99999986128987----------------83899973881437308887701


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99825878689998999860898998625781313228999999973177410234788879999898
Q gi|254780270|r  504 IIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARK  571 (820)
Q Consensus       504 ~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~  571 (820)
T Consensus       142 ~--~~~~~-~~~~~~~~~~~~~-------~~~~~i~~~~~s~de~~~~~~~gs-~~~~l~il~~~i~~  198 (262)
T PRK05818        142 Q--YVVLS-KEKKVPFKVESND-------RYFQYILLSFYSVDEQLQAYNNGS-FSKLKNIIETLINK  198 (262)
T ss_pred             C--CCCCC-HHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHC
T ss_conf             4--46664-3466788887408-------889876410110799998861676-88899999999875