HHsearch alignment for GI: 254780270 and conserved domain: PRK05896

>PRK05896 DNA polymerase III subunits gamma and tau; Validated.
Probab=99.35  E-value=1.8e-10  Score=98.06  Aligned_cols=212  Identities=20%  Similarity=0.309  Sum_probs=135.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-------------EEEEECCCCCCH
Q ss_conf             6520116899999999999984244467359986056565027999999770882-------------499861888888
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ-------------YVRMSLGGVYDE  405 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~-------------f~~islgg~~d~  405 (820)
T Consensus        16 ~eIIGQe~iv~~L~nA-----I~~~RiaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~dpCg~C~sC~~I~~g~h~Dv   90 (613)
T PRK05896         16 KQIIGQELIKKILVNA-----ILNNKLTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDGDCCNSCSVCESINTNQSVDI   90 (613)
T ss_pred             HHHCCCHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             5523829999999999-----98499762277558998488999999999966999999998888878999856999986


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHH--CCCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             883563200145671289999983--278873999933155423117711556655406001681332010352364427
Q gi|254780270|r  406 ADIRGHRRTYIGSMPGRIIQSLKR--AKRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       406 ~~i~gh~~ty~ga~pg~ii~~l~~--~~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v  483 (820)
T Consensus        91 iEIdaasn~gIDeIR-eLie~~~~~P~~gkyKV~IIDEah~Ln~~----AaNALLKtLE-------------EPP--~~v  150 (613)
T PRK05896         91 VELDAASNNGVDEIR-NIIDNINYLPTTFKYKVYIIDEAHMLSTS----AWNALLKTLE-------------EPP--KHV  150 (613)
T ss_pred             EEEECCCCCCHHHHH-HHHHHHCCCCCCCCCEEEEECCHHHCCHH----HHHHHHHHCC-------------CCC--CCC
T ss_conf             884065557889999-99997085875799459998162217999----9999998534-------------898--783


Q ss_pred             EEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             9999348655-441311724799825878689998999860898998625781313228999999973177410234788
Q gi|254780270|r  484 MFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFE  562 (820)
Q Consensus       484 ~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~  562 (820)
T Consensus       151 iFIL~Ttep~KLLpTIlSRCQrf~Fkri~~~~I~~---------~L~~I-~~kE~i~ie~~AL~~Ia~~--adGs~RDAl  218 (613)
T PRK05896        151 VFIFATTEFQKIPLTIISRCQRYNFKKLNNSELQE---------LLKSI-AKKEKIKIEDNAIDKIADL--ADGSLRDGL  218 (613)
T ss_pred             EEEEEECCHHHCCHHHHHCCCCEECCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHHHH
T ss_conf             79998288154937664035500178899899999---------99999-9973998789999999997--688487898


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHCC
Q ss_conf             87999989876542117852012796786753052
Q gi|254780270|r  563 RALMKIARKAVTKIVKNSDTTVSINENNLQDYLGV  597 (820)
Q Consensus       563 r~i~~i~r~~~~~~~~~~~~~~~i~~~~l~~~lg~  597 (820)
T Consensus       219 slLdQ~~~~~~----------~~it~~~v~~~~g~  243 (613)
T PRK05896        219 SILDQLSTFKN----------KKIDIEDINKTFGL  243 (613)
T ss_pred             HHHHHHHHHCC----------CCCCHHHHHHHHCC
T ss_conf             89999998356----------88629999999677