HHsearch alignment for GI: 254780270 and conserved domain: PRK07133

>PRK07133 DNA polymerase III subunits gamma and tau; Validated.
Probab=99.28  E-value=3.1e-10  Score=96.32  Aligned_cols=190  Identities=20%  Similarity=0.316  Sum_probs=129.0

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE----------EEEECCCCCCHHHH
Q ss_conf             65201168999999999999842444673599860565650279999997708824----------99861888888883
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY----------VRMSLGGVYDEADI  408 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f----------~~islgg~~d~~~i  408 (820)
T Consensus        18 ~EVIGQe~Vv~tL~nA-----I~~gRIaHAYLF~GPRGvGKTT~ARIfAKaLNC~~~~d~~~pC~~C~~~~~~s~DViEI   92 (718)
T PRK07133         18 DEIKGQDHIIETLKNI-----IKSGKISHAYLFSGPHGTGKTSVAKIFANALNCSHKTDLIEPCQNCIENFNNNLDIIEM   92 (718)
T ss_pred             HHHCCCHHHHHHHHHH-----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHCCCCCCCEEEE
T ss_conf             4422859999999999-----97499750586238998688999999999967999999999770214304789873775


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCC------CEEEEEECHHHHHHHCCCCHHHHHHHHCC-CCCCCCEEEEECCCCCCCC
Q ss_conf             5632001456712899999832788------73999933155423117711556655406-0016813320103523644
Q gi|254780270|r  409 RGHRRTYIGSMPGRIIQSLKRAKRS------NPLLLLDEIDKMGSDLRGDPSAALLEVLD-PAQNSSFVDHYLEVEYDLS  481 (820)
Q Consensus       409 ~gh~~ty~ga~pg~ii~~l~~~~~~------npv~~ldeidk~~~~~~gdp~~allevld-p~qn~~f~d~y~~~~~dls  481 (820)
T Consensus        93 DAASn~gVDd-----IReLie~v~y~P~~gkYKVyIIDEvHMLS~~----AfNALLKtLEEPP----------------~  147 (718)
T PRK07133         93 DAASNNGVDE-----IRELRENVKNLPQISKYKIYIIDEVHMLSKS----AFNALLKTLEEPP----------------K  147 (718)
T ss_pred             CCCCCCCHHH-----HHHHHHHHCCCCCCCCEEEEEEECCCCCCHH----HHHHHHHHHCCCC----------------C
T ss_conf             4556688899-----9999998255887787249999662007999----9999998502798----------------7


Q ss_pred             CEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHH
Q ss_conf             279999348655-4413117247998258786899989998608989986257813132289999999731774102347
Q gi|254780270|r  482 DVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRS  560 (820)
Q Consensus       482 ~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~  560 (820)
T Consensus       148 hvvFILaTTep~KIP~TIlSRCQrFdFkrI~~~~I~~---------~L~~I-~~kE~I~~e~eAL~lIA~~--a~GSmRD  215 (718)
T PRK07133        148 HVIFILATTDVQKIPLTILSRVQRFNFRRISEDVIVH---------QLENI-LEKEKIKYEKNALKLIASL--ASGSLRD  215 (718)
T ss_pred             CCEEEEEECCHHHCCHHHHHCCEEEECCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCHHH
T ss_conf             8279997088254848774122033588899999999---------99999-9985997789999999997--6884888


Q ss_pred             HHHHHHHHHH
Q ss_conf             8887999989
Q gi|254780270|r  561 FERALMKIAR  570 (820)
Q Consensus       561 l~r~i~~i~r  570 (820)
T Consensus       216 AlSlLDQv~~  225 (718)
T PRK07133        216 ALSIADQVSI  225 (718)
T ss_pred             HHHHHHHHHH
T ss_conf             9879999998