HHsearch alignment for GI: 254780270 and conserved domain: PRK07276

>PRK07276 DNA polymerase III subunit delta'; Validated.
Probab=97.94  E-value=6.7e-05  Score=55.95  Aligned_cols=162  Identities=15%  Similarity=0.214  Sum_probs=94.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCE--EEEECCCCCCHHHH--CCCC-CCCCCC
Q ss_conf             168999999999999842444673599860565650279999997708824--99861888888883--5632-001456
Q gi|254780270|r  344 LEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQY--VRMSLGGVYDEADI--RGHR-RTYIGS  418 (820)
Q Consensus       344 l~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f--~~islgg~~d~~~i--~gh~-~ty~ga  418 (820)
T Consensus         3 ~~~~Qp~i~~~l-~~~i~~~rl~HAyLf~G--~~Gk~~~A~~~A~~l~C~~~~~~~pCg~C~~C~~i~~~~hpDv~~i~~   79 (290)
T PRK07276          3 LAQKQPKLFQRF-QTILEQDRLNHAYLFSG--DFASFEMALFLAQSLFCEQKEDVLPCGHCRSCRLIEQGDFSDVTVIEP   79 (290)
T ss_pred             HHHHHHHHHHHH-HHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCCEEECC
T ss_conf             778789999999-99998499650542169--868799999999998189999989898899999987699987137716


Q ss_pred             CCHH--------HHHHHHHCC--CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEE
Q ss_conf             7128--------999998327--887399993315542311771155665540600168133201035236442799993
Q gi|254780270|r  419 MPGR--------IIQSLKRAK--RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMT  488 (820)
Q Consensus       419 ~pg~--------ii~~l~~~~--~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~t  488 (820)
T Consensus        80 ~~~~I~vd~IR~l~~~~~~~~~~g~~KV~II~~Ad~mt~~----AaNaLLK~LE-------------EPp--~~t~~iLl  140 (290)
T PRK07276         80 QGQVIKTDTIRELTANFSQSGYEGKRQVFIIKDADKMHVN----AANSLLKVIE-------------EPQ--SEIYIFLL  140 (290)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCHHHCCHH----HHHHHHHHHC-------------CCC--CCCEEEEE
T ss_conf             7775768899999999844561378279997765652999----9999999703-------------898--88379988


Q ss_pred             CCCCC-CCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             48655-44131172479982587868999899986089899862578131
Q gi|254780270|r  489 ANTLN-IPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEE  537 (820)
Q Consensus       489 an~~~-i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~  537 (820)
T Consensus       141 t~~~~~lLpTI~SRCQ~i~fp~-~~~--------~l-~~~l~~~gi~~~~  180 (290)
T PRK07276        141 TNDENKVLPTIKSRTQIFHFPK-NEA--------YL-YQLLEEKGLLKTQ  180 (290)
T ss_pred             ECCHHHCCHHHHHCCCCCCCCC-CHH--------HH-HHHHHHCCCCHHH
T ss_conf             7992549378873660102899-679--------99-9999986998679