HHsearch alignment for GI: 254780270 and conserved domain: PRK07471

>PRK07471 DNA polymerase III subunit delta'; Validated.
Probab=98.73  E-value=1.5e-07  Score=76.04  Aligned_cols=154  Identities=18%  Similarity=0.301  Sum_probs=96.6

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHH--HC-CC---C
Q ss_conf             652011689999999999998424446735998605656502799999977088249986188888888--35-63---2
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEAD--IR-GH---R  412 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~--i~-gh---~  412 (820)
T Consensus        17 ~~liGqe~~~~~L~~a~~~-----grl~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~p~~r   91 (363)
T PRK07471         17 TALFGHAAAEAALLDAYRS-----GRLHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDHPVAR   91 (363)
T ss_pred             CCCCCHHHHHHHHHHHHHC-----CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHH
T ss_conf             7316819999999999985-----99764587679998188999999999985799977777678705312587772899


Q ss_pred             CCCCCCCCHH------------------HHHHHHHC---------CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCC-CC
Q ss_conf             0014567128------------------99999832---------78873999933155423117711556655406-00
Q gi|254780270|r  413 RTYIGSMPGR------------------IIQSLKRA---------KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLD-PA  464 (820)
Q Consensus       413 ~ty~ga~pg~------------------ii~~l~~~---------~~~npv~~ldeidk~~~~~~gdp~~allevld-p~  464 (820)
T Consensus        92 ~i~~~~hpdl~~i~r~~d~k~~~~~~~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~mn~~----aaNALLK~LEEPP  167 (363)
T PRK07471         92 RIAAGAHGGLLTLERSWNEKGKRLRTVITVDEVRETIGFFGLTAAEGGWRVVIVDTADEMNAN----AANALLKVLEEPP  167 (363)
T ss_pred             HHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHCHH----HHHHHHHHHCCCC
T ss_conf             995269998466762001133321244539999999999724852489669998687873889----9999999721589


Q ss_pred             CCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHCCCEEEEEECCCCHHHHHH
Q ss_conf             16813320103523644279999348655-441311724799825878689998
Q gi|254780270|r  465 QNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLMDRMEIIRIAGYTEEEKLQ  517 (820)
Q Consensus       465 qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~drme~i~~~~y~~~ek~~  517 (820)
T Consensus       168 ----------------~~t~fiLit~~~~~llpTI~SRCq~~~~~~l~~~~~~~  205 (363)
T PRK07471        168 ----------------ARSLLLLVSHAPARLLPTIRSRCRKLRLRPLAPEDVIA  205 (363)
T ss_pred             ----------------CCEEEEEEECCHHHCHHHHHHHCCCCCCCCCCHHHHHH
T ss_conf             ----------------88389986399777779999735242589959999999