HHsearch alignment for GI: 254780270 and conserved domain: PRK09111

>PRK09111 DNA polymerase III subunits gamma and tau; Validated.
Probab=98.86  E-value=6.8e-08  Score=78.61  Aligned_cols=198  Identities=20%  Similarity=0.269  Sum_probs=134.8

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC------------------EEEEECCCCCCHHHHCCCCCCCCCCCC
Q ss_conf             84244467359986056565027999999770882------------------499861888888883563200145671
Q gi|254780270|r  359 MRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQ------------------YVRMSLGGVYDEADIRGHRRTYIGSMP  420 (820)
Q Consensus       359 ~~~~~~~g~il~l~gppgvGKts~~~sia~al~r~------------------f~~islgg~~d~~~i~gh~~ty~ga~p  420 (820)
T Consensus        38 ~~~~~~~~~a~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~daas~~~v~~~r  117 (600)
T PRK09111         38 AFETGRIAQAFMLTGVRGVGKTTTARILARALNYKGPDGVGGPTIDPCGVGEHCQAIMEGRHVDVIEMDAASHTGVDDIR  117 (600)
T ss_pred             HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCHHHHH
T ss_conf             99729842047645789878999999999996698876668998898998865898866899875885155457888999


Q ss_pred             HHHHHHHHHC--CCCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHH
Q ss_conf             2899999832--788739999331554231177115566554060016813320103523644279999348655-4413
Q gi|254780270|r  421 GRIIQSLKRA--KRSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLP  497 (820)
Q Consensus       421 g~ii~~l~~~--~~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~  497 (820)
T Consensus       118 ~-~~~~~~~~p~~~~~kv~iidevhmls~~a----fnallktle-------------epp--~~~~fi~att~~~k~p~t  177 (600)
T PRK09111        118 E-IIESVRYRPVSARYKVYIIDEVHMLSTAA----FNALLKTLE-------------EPP--PHVKFIFATTEIRKVPVT  177 (600)
T ss_pred             H-HHHHHCCCCCCCCEEEEEEECCCCCCHHH----HHHHHHHHH-------------CCC--CCEEEEEECCCHHHCCHH
T ss_conf             9-99860538877754699960011057999----999998762-------------598--654999962853437589


Q ss_pred             HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11724799825878689998999860898998625781313228999999973177410234788879999898765421
Q gi|254780270|r  498 LMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIV  577 (820)
Q Consensus       498 l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~  577 (820)
T Consensus       178 i~src~~f~~~~~~~~~~~~---------~l~~i-~~~e~~~~~~~al~~ia~~--a~GS~RDaLSlLDQai---~----  238 (600)
T PRK09111        178 VLSRCQRFDLRRIEAEVLAA---------HLARI-AEKEGVEVEPDALALIARA--AEGSVRDGLSLLDQAI---A----  238 (600)
T ss_pred             HHHHHHEECCCCCCHHHHHH---------HHHHH-HHHCCCCCCHHHHHHHHHH--CCCCCCHHHHHHHHHH---H----
T ss_conf             98544120105799999999---------99999-9860768667799999997--4898421899999999---7----


Q ss_pred             CCCCCEECCCHHHHHHHHCCC
Q ss_conf             178520127967867530520
Q gi|254780270|r  578 KNSDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       578 ~~~~~~~~i~~~~l~~~lg~~  598 (820)
T Consensus       239 ~~~---~~i~~~~v~~mLGl~  256 (600)
T PRK09111        239 HGA---GEVTAEQVRDMLGLA  256 (600)
T ss_pred             CCC---CCCCHHHHHHHHCCC
T ss_conf             279---875699999986887