HHsearch alignment for GI: 254780270 and conserved domain: PRK09452

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed.
Probab=94.56  E-value=0.049  Score=34.24  Aligned_cols=39  Identities=36%  Similarity=0.542  Sum_probs=30.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
T Consensus        41 ~~GE~~~llGpSGsGKSTLlr~iaGl~~p~sG~I~~~G~   79 (378)
T PRK09452         41 NNGEFLTLLGPSGCGKTTVLRLIAGFETPDSGRIMLDGQ   79 (378)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCE
T ss_conf             999899999899976999999997699998469999999