HHsearch alignment for GI: 254780270 and conserved domain: PRK09563

>PRK09563 rbgA ribosomal biogenesis GTPase; Reviewed.
Probab=94.42  E-value=0.057  Score=33.72  Aligned_cols=50  Identities=34%  Similarity=0.517  Sum_probs=33.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             9986056565027999999770882499861888888883563200145671289999983278873999933
Q gi|254780270|r  369 LCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDE  441 (820)
Q Consensus       369 l~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv~~lde  441 (820)
T Consensus       124 v~vvG~PNVGKSSlIN~L~----------------------~~k~~~v~~~PG~T-k~~q~v~l~~~i~L~Dt  173 (282)
T PRK09563        124 AMIIGIPNVGKSTLINRLA----------------------GKKIAKTGNRPGVT-KSQQWIKLGKGLELLDT  173 (282)
T ss_pred             EEEEECCCCCHHHHHHHHH----------------------CCCEEEECCCCCCE-EEEEEEEECCCEEEECC
T ss_conf             9997069776799999874----------------------77058767965410-02589995798899668