HHsearch alignment for GI: 254780270 and conserved domain: PRK10253

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional.
Probab=94.87  E-value=0.034  Score=35.48  Aligned_cols=38  Identities=24%  Similarity=0.473  Sum_probs=29.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
T Consensus        31 ~~Ge~~~iiGpNGaGKSTLlk~i~Gll~p~~G~I~l~g   68 (265)
T PRK10253         31 PDGHFTAIIGPNGCGKSTLLRTLSRLMTPAHGHVWLDG   68 (265)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             59979999999883999999999749888852999999