HHsearch alignment for GI: 254780270 and conserved domain: PRK10923

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional.
Probab=98.99  E-value=2e-08  Score=82.69  Aligned_cols=202  Identities=21%  Similarity=0.370  Sum_probs=132.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHC---CCEEEEECCCCCC---HHHHCCCCCC-CCCCC---CHHHHHHHHHCCC
Q ss_conf             44673599860565650279999997708---8249986188888---8883563200-14567---1289999983278
Q gi|254780270|r  363 KNKGLILCFVGPPGVGKTSLAQSIAKATG---RQYVRMSLGGVYD---EADIRGHRRT-YIGSM---PGRIIQSLKRAKR  432 (820)
Q Consensus       363 ~~~g~il~l~gppgvGKts~~~sia~al~---r~f~~islgg~~d---~~~i~gh~~t-y~ga~---pg~ii~~l~~~~~  432 (820)
T Consensus       159 ~~~~pVL-I~GE~GTGK~~~Ar~IH~~S~r~~~pfi~vnC~~~~~~~~e~eLFG~~~gaf~ga~~~~~g~~e~a------  231 (469)
T PRK10923        159 RSSISVL-INGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQA------  231 (469)
T ss_pred             CCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHC------
T ss_conf             8899789-989898269999999997488779995787678899778999970876678788642458736643------


Q ss_pred             CCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEE--ECCCCCCCCCEEEEEECCC-C-C------CCHHHCCCE
Q ss_conf             8739999331554231177115566554060016813320--1035236442799993486-5-5------441311724
Q gi|254780270|r  433 SNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDH--YLEVEYDLSDVMFIMTANT-L-N------IPLPLMDRM  502 (820)
Q Consensus       433 ~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~--y~~~~~dls~v~fi~tan~-~-~------i~~~l~drm  502 (820)
T Consensus       232 ~~GTLfLdeI~~L~~~~Q~----kLl~~L~---~~~~~~~g~~~~~~~---d~RiIaat~~~L~~~v~~g~Fr~dLyyrL  301 (469)
T PRK10923        232 DGGTLFLDEIGDMPLDVQT----RLLRVLA---DGQFYRVGGYAPVKV---DVRIIAATHQNLEQRVQEGKFREDLFHRL  301 (469)
T ss_pred             CCCCEEHHHHHHCCHHHHH----HHHHHHH---CCCEEECCCCCEEEE---CCEEEEECCCCHHHHHHHCCHHHHHHHHH
T ss_conf             8992656636648999999----9999985---593785799851221---43799707879999866081779999864


Q ss_pred             EE--EEECCCCH--HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             79--98258786--899989998608989986257813132289999999731774102347888799998987654211
Q gi|254780270|r  503 EI--IRIAGYTE--EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVK  578 (820)
Q Consensus       503 e~--i~~~~y~~--~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~  578 (820)
T Consensus       302 ~~~~I~lPpLReR~eDI~~L~-~~fl~~~~~~~~~--~~~~~s~~a~~~-L~~y~WPGNvrEL~n~ier~~~~-----~~  372 (469)
T PRK10923        302 NVIRVHLPPLRERREDIPRLA-RHFLQVAARELGV--EAKLLHPETEAA-LTRLAWPGNVRQLENTCRWLTVM-----AA  372 (469)
T ss_pred             HHHCCCCCCHHHCHHHHHHHH-HHHHHHHHHHCCC--CCCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHHHH-----CC
T ss_conf             424015846544653499999-9999999998599--978789999999-97499998799999999999985-----79


Q ss_pred             CCCCEECCCHHHHHHH
Q ss_conf             7852012796786753
Q gi|254780270|r  579 NSDTTVSINENNLQDY  594 (820)
Q Consensus       579 ~~~~~~~i~~~~l~~~  594 (820)
T Consensus       373 ~~----~i~~~dl~~~  384 (469)
T PRK10923        373 GQ----EVLIQDLPGE  384 (469)
T ss_pred             CC----CCCHHHCCHH
T ss_conf             98----2547757298