HHsearch alignment for GI: 254780270 and conserved domain: PRK11231

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional.
Probab=94.96  E-value=0.031  Score=35.75  Aligned_cols=39  Identities=31%  Similarity=0.478  Sum_probs=31.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
T Consensus        26 ~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~sG~I~i~g~   64 (255)
T PRK11231         26 PTGKITALIGPNGCGKSTLLKCFARLLTPQSGTVFLGDK   64 (255)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCE
T ss_conf             899799999999981999999997598888648999999