HHsearch alignment for GI: 254780270 and conserved domain: PRK11608

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional.
Probab=98.99  E-value=3.6e-08  Score=80.72  Aligned_cols=190  Identities=16%  Similarity=0.319  Sum_probs=120.1

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCC---CEEEEECCCCCC---HHHHCCCCCC-CCCC---CCHHHHHHHHHCC
Q ss_conf             4446735998605656502799999977088---249986188888---8883563200-1456---7128999998327
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGR---QYVRMSLGGVYD---EADIRGHRRT-YIGS---MPGRIIQSLKRAK  431 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r---~f~~islgg~~d---~~~i~gh~~t-y~ga---~pg~ii~~l~~~~  431 (820)
T Consensus        26 A~~~~pVL-I~GE~GtGK~~~Ar~IH~~S~r~~~pfi~v~C~~l~~~~~e~~LFG~~~g~~~~~~~~~~g~le~------   98 (325)
T PRK11608         26 APLDKPVL-IIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFER------   98 (325)
T ss_pred             HCCCCCEE-EECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHC------
T ss_conf             68899989-88989837999999999658867999778877989977889987277556767753246873435------


Q ss_pred             CCCEEEEEECHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCC-C-C-C-----CHHHCCCE-
Q ss_conf             887399993315542311771155665540600168133201035236442799993486-5-5-4-----41311724-
Q gi|254780270|r  432 RSNPLLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANT-L-N-I-----PLPLMDRM-  502 (820)
Q Consensus       432 ~~npv~~ldeidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~-~-~-i-----~~~l~drm-  502 (820)
T Consensus        99 a~gGTL~L~eI~~l~~~~Q~----~Ll~~l~---~~~~~r~g~~~~~~-~~~RiIa~t~~~l~~lv~~g~fr~dLy~rL~  170 (325)
T PRK11608         99 ADGGTLFLDELATAPMLVQE----KLLRVIE---YGELERVGGSQPLQ-VNVRLVCATNADLPAMVNEGTFRADLLDRLA  170 (325)
T ss_pred             CCCCEEEEECHHHCCHHHHH----HHHHHHH---CCCEEECCCCCCCC-CCEEEEECCCHHHHHHHHHCCCHHHHHHHHH
T ss_conf             68986997374547999999----9999986---49088579987665-6468871332208999983956799985653


Q ss_pred             -EEEEECCCCH--HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             -7998258786--899989998608989986257813132289999999731774102347888799998
Q gi|254780270|r  503 -EIIRIAGYTE--EEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIA  569 (820)
Q Consensus       503 -e~i~~~~y~~--~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~  569 (820)
T Consensus       171 ~~~I~lPpLReR~eDI~~L~~~f-l~~~~~~~~~~~-~~~~s~~a~~~-L~~y~WPGNvrEL~n~ierav  237 (325)
T PRK11608        171 FDVVQLPPLRERQSDIMLMAEHF-AIQMCRELGLPL-FPGFTERARET-LLNYRWPGNIRELKNVVERSV  237 (325)
T ss_pred             HHHCCCCCHHHCCCCHHHHHHHH-HHHHHHHCCCCC-CCCCCHHHHHH-HHCCCCCCHHHHHHHHHHHHH
T ss_conf             01115868454710199999999-999999829998-88889999999-961999965999999999999