HHsearch alignment for GI: 254780270 and conserved domain: PRK11650

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional.
Probab=95.34  E-value=0.021  Score=37.04  Aligned_cols=38  Identities=29%  Similarity=0.529  Sum_probs=30.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
T Consensus        28 ~~Ge~~~llGpsG~GKTTllr~iaGl~~p~~G~I~~~g   65 (358)
T PRK11650         28 ADGEFIVLVGPSGCGKSTLLRMVAGLERITSGEIWIGG   65 (358)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             89989999999863699999999769998862999999