HHsearch alignment for GI: 254780270 and conserved domain: PRK11823

>PRK11823 DNA repair protein RadA; Provisional.
Probab=99.73  E-value=8.1e-17  Score=146.18  Aligned_cols=343  Identities=22%  Similarity=0.294  Sum_probs=194.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHCCC-CCEEEEEE
Q ss_conf             44467359986056565027999999770882499861888888883563200145671289999983278-87399993
Q gi|254780270|r  362 IKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKR-SNPLLLLD  440 (820)
Q Consensus       362 ~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~~~i~gh~~ty~ga~pg~ii~~l~~~~~-~npv~~ld  440 (820)
T Consensus        86 GlV~GS~iLlgGePGIGKSTLlLQ~a~~la~~~~vLYvSGEES~~Qik~--------------RA-~RLg~~~~~l~l~~  150 (454)
T PRK11823         86 GLVPGSVVLIGGDPGIGKSTLLLQVAAALAAGGKVLYVSGEESLQQIKL--------------RA-ERLGLPSDNLYLLA  150 (454)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHH--------------HH-HHHCCCCCCCEEEE
T ss_conf             7206648995079988899999999999855995799815015789999--------------99-97588888737885


Q ss_pred             CHHHHHHHCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHCCCEEEEEECCCCHHHHHHHHH
Q ss_conf             31554231177115566554060016813320103523644279999348655441311724799825878689998999
Q gi|254780270|r  441 EIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQIAK  520 (820)
Q Consensus       441 eidk~~~~~~gdp~~allevldp~qn~~f~d~y~~~~~dls~v~fi~tan~~~i~~~l~drme~i~~~~y~~~ek~~i~~  520 (820)
T Consensus       151 et~l~-------~Il~~i~~~~P~----~------lIIDSIQT~~~~~~~s--~pG--------------svsQVre~a-  196 (454)
T PRK11823        151 ETNLE-------DILATIEEEKPD----L------VVIDSIQTMYSPELES--APG--------------SVSQVRECA-  196 (454)
T ss_pred             CCCHH-------HHHHHHHHHCCC----E------EEEECHHEEEECCCCC--CCC--------------CHHHHHHHH-
T ss_conf             36899-------999999860998----8------9994311154156677--899--------------789999999-


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCC---CHHHHHHHHHHHHH-----HHHHHHHHCC---------CCCE
Q ss_conf             86089899862578131322899999997317741---02347888799998-----9876542117---------8520
Q gi|254780270|r  521 NHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHE---AGVRSFERALMKIA-----RKAVTKIVKN---------SDTT  583 (820)
Q Consensus       521 ~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~E---aGvR~l~r~i~~i~-----r~~~~~~~~~---------~~~~  583 (820)
T Consensus       197 -~~L~~~AK~~~i~~-----------~lVGHVTKdG~iAGPkvLEHmVDtVl~fEGd~~~~~RiLR~~KNRFG~t~EiGv  264 (454)
T PRK11823        197 -AELTRLAKQSGIAV-----------FLVGHVTKEGAIAGPRVLEHMVDTVLYFEGDRHSRFRILRAVKNRFGATNEIGV  264 (454)
T ss_pred             -HHHHHHHHHCCCCE-----------EEEEEECCCCCCCCCHHHHHHHCEEEEECCCCCCCCEEEEEECCCCCCCCEEEE
T ss_conf             -99999997449828-----------999977267764661452220104687515766550245631246776660589


Q ss_pred             ECCCHHHHHHHHCCCCC-CCCCHHCCCCCCCCCEEEECCCCCEEEEEE--EEEEC---CCCCEEECCCHHHHHHHHHHHH
Q ss_conf             12796786753052000-332000223365000000000168079999--99974---8997244325689999999999
Q gi|254780270|r  584 VSINENNLQDYLGVPRY-KYGKIEGEDQVGIVTGLAWTEVGGEILTVE--GVIMP---GKGEITITGNLKEIMKESILAA  657 (820)
Q Consensus       584 ~~i~~~~l~~~lg~~~~-~~~~~~~~~~~G~v~GLa~t~~GG~~l~IE--~~~~~---g~g~l~lTG~lg~vmkES~~~A  657 (820)
T Consensus       265 FeM~~~GL~~v~nPS~~Fls~~--~~~~~Gs~i~~~~--EGsRpllvEvQALv~~~~~~~PrR~~~G~------d~~Rl~  334 (454)
T PRK11823        265 FEMTEKGLREVSNPSELFLSER--DENVPGSAVTVTM--EGTRPLLVEIQALVSPSSFGNPRRVAVGL------DQNRLA  334 (454)
T ss_pred             EEECCCCCEECCCHHHHHHHCC--CCCCCCEEEEEEE--EECCCHHHHHHHHHCCCCCCCCEEEEECC------CHHHHH
T ss_conf             9861688456688779986268--8787750799888--50642401034461567788871578058------789999


Q ss_pred             HHHHHHHH-HHCCCCHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCEEEEECCHH
Q ss_conf             99999988-86299855742078147448888478887306899999999983688875610663685030250006568
Q gi|254780270|r  658 SSYVRSKA-TTFGIIPSAFNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLK  736 (820)
Q Consensus       658 ~s~~k~~~-~~~~~~~~~~~~~diHih~p~Ga~pKDGPSAGi~i~tal~S~~~~~~v~~~iAmTGEitl~G~VlpiGGi~  736 (820)
T Consensus       335 mll--AVlek~~~~~---l~~~DVyvnv~-GG~ki~epa~DLAva~Ai~SS~~~~~i~~~~~~~GEVGL~GEiR~V~~~~  408 (454)
T PRK11823        335 MLL--AVLEKRLGLP---LSDQDVYVNVV-GGLKITEPAADLAVALAIASSLRDRPLPPDTVVFGEVGLSGEIRPVPRGE  408 (454)
T ss_pred             HHH--HHHHHHHCCC---CCCCCEEEECC-CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCEEECCCCHH
T ss_conf             999--9999984986---22664799914-78415785477999999998704977898828999413670342689889


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHHCCHHHHCCCEEEECCCHHHHHHHHHC
Q ss_conf             9999999709969980367755077614887709799981939998887602
Q gi|254780270|r  737 EKLLAALRAGVTKVLIPEENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALL  788 (820)
Q Consensus       737 eK~laA~raGi~~viiP~~N~~d~~~ip~~~~~~l~~~~v~~~~evl~~al~  788 (820)
T Consensus       409 ~Rl~EA~rlGf~~~ivP~~~~~~---~----~~~i~i~~v~~i~e~i~~l~~  453 (454)
T PRK11823        409 ERLKEAAKLGFKRAIVPKANPKK---A----PEGIEVIGVKTLKEALELLFG  453 (454)
T ss_pred             HHHHHHHHCCCCEEEECCCCCCC---C----CCCCEEEEECCHHHHHHHHHC
T ss_conf             99999998699889957877767---9----999799995979999999758