HHsearch alignment for GI: 254780270 and conserved domain: PRK11860

>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional.
Probab=95.49  E-value=0.033  Score=35.58  Aligned_cols=35  Identities=31%  Similarity=0.619  Sum_probs=30.6

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
Q ss_conf             24446735998605656502799999977088249
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYV  395 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~  395 (820)
T Consensus       437 ~~~~~~pIIaIDGpagsGKsT~ak~lA~~l~~~yl  471 (662)
T PRK11860        437 AAAARIPVICIDGPTASGKGTLAAAVAQALGYHYL  471 (662)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             34567878996578756868999999999599676