HHsearch alignment for GI: 254780270 and conserved domain: PRK12727

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional.
Probab=95.74  E-value=0.064  Score=33.35  Aligned_cols=58  Identities=24%  Similarity=0.421  Sum_probs=31.3

Q ss_pred             HCHHHHHHHHHHHHHHHHHCC----CCCCCEEEEECCCCCCHHHH-HHHHHH-HHC---CCEEEEEC
Q ss_conf             011689999999999998424----44673599860565650279-999997-708---82499861
Q gi|254780270|r  342 FGLEKVKERIIEYLAVQMRVI----KNKGLILCFVGPPGVGKTSL-AQSIAK-ATG---RQYVRMSL  399 (820)
Q Consensus       342 yGl~~vK~rile~lav~~~~~----~~~g~il~l~gppgvGKts~-~~sia~-al~---r~f~~isl  399 (820)
T Consensus       320 ~~~~~a~~~ll~~La~~Lpv~~~d~~~~gGv~AlvGpTGvGKTTT~aKlAa~~~~~~g~~~valit~  386 (557)
T PRK12727        320 TELHRGRGLMLGLLSKRLPVAPVDPLERGGVIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTT  386 (557)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             7888999999999996287777751540764787437776731179999999999739981899972