HHsearch alignment for GI: 254780270 and conserved domain: PRK13548

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional.
Probab=94.76  E-value=0.034  Score=35.44  Aligned_cols=39  Identities=23%  Similarity=0.421  Sum_probs=30.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
T Consensus        26 ~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~~G~I~~~g~   64 (257)
T PRK13548         26 RPGEVVAILGPNGAGKSTLLRALSGELPPSSGEVRLFGR   64 (257)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECE
T ss_conf             699899999999987999999985675778756999365