HHsearch alignment for GI: 254780270 and conserved domain: PRK13635

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=94.51  E-value=0.04  Score=34.95  Aligned_cols=39  Identities=26%  Similarity=0.407  Sum_probs=29.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             467359986056565027999999770882499861888
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV  402 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~  402 (820)
T Consensus        31 ~~GE~vaivG~nGsGKSTL~k~l~Gl~~p~~G~I~i~G~   69 (279)
T PRK13635         31 YEGEWVAIVGHNGSGKSTLAKLLNGLLLPEAGTITVGGM   69 (279)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCE
T ss_conf             799899999999965999999997288888964999999