HHsearch alignment for GI: 254780270 and conserved domain: PRK13768

>PRK13768 GTPase; Provisional.
Probab=95.02  E-value=0.038  Score=35.05  Aligned_cols=38  Identities=26%  Similarity=0.514  Sum_probs=29.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHH---HHHCCCEEEEECCCCCC
Q ss_conf             359986056565027999999---77088249986188888
Q gi|254780270|r  367 LILCFVGPPGVGKTSLAQSIA---KATGRQYVRMSLGGVYD  404 (820)
Q Consensus       367 ~il~l~gppgvGKts~~~sia---~al~r~f~~islgg~~d  404 (820)
T Consensus         3 ~~~~ViGpaGSGKsT~~~~l~~~l~~~~r~~~vvNLDPA~e   43 (253)
T PRK13768          3 YIVFFLGTAGSGKTTLVGALSDWLEEQGYDVAIVNLDPAVE   43 (253)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             18999899999889999999999997699759997898665