HHsearch alignment for GI: 254780270 and conserved domain: TIGR02397

>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=98.96  E-value=2.6e-08  Score=81.75  Aligned_cols=193  Identities=24%  Similarity=0.345  Sum_probs=137.5

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE-------------EECCCCCCHHHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             244467359986056565027999999770882499-------------8618888888835632001456712899999
Q gi|254780270|r  361 VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVR-------------MSLGGVYDEADIRGHRRTYIGSMPGRIIQSL  427 (820)
Q Consensus       361 ~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~-------------islgg~~d~~~i~gh~~ty~ga~pg~ii~~l  427 (820)
T Consensus        31 ~~~ri~HAYLF~GpRGtGKTS~ARIfAKaLNC~-~~~~~PCn~C~~C~~i~~g~~~DviEiDAASN~gVD~-----IR~l  104 (363)
T TIGR02397        31 KNGRIAHAYLFSGPRGTGKTSIARIFAKALNCQ-GPDGEPCNECESCKEINSGSSLDVIEIDAASNNGVDD-----IREL  104 (363)
T ss_pred             HHCCCCCEEEECCCCCCCHHHHHHHHHHHHCCC-CCCCCCCCCCCHHHHHHCCCCCCEEEECCCCCCCHHH-----HHHH
T ss_conf             718966234502859976355899999986588-7877877775022776528986668864865687889-----9999


Q ss_pred             HHCCCCCE------EEEEECHHHHHHHCCCCHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCEEEEEECCCCC-CCHHHC
Q ss_conf             83278873------99993315542311771155665540-60016813320103523644279999348655-441311
Q gi|254780270|r  428 KRAKRSNP------LLLLDEIDKMGSDLRGDPSAALLEVL-DPAQNSSFVDHYLEVEYDLSDVMFIMTANTLN-IPLPLM  499 (820)
Q Consensus       428 ~~~~~~np------v~~ldeidk~~~~~~gdp~~allevl-dp~qn~~f~d~y~~~~~dls~v~fi~tan~~~-i~~~l~  499 (820)
T Consensus       105 ~e~v~y~P~~~kYKvYIIDEVHMLS~~A----FNALLKTLEEPP----------------~hV~FIlATTE~~KiP~TIl  164 (363)
T TIGR02397       105 RENVKYAPSKGKYKVYIIDEVHMLSKSA----FNALLKTLEEPP----------------EHVVFILATTEPHKIPATIL  164 (363)
T ss_pred             HHHHCCCCCCCCCCEEEEECCCCCCHHH----HHHHHHHHCCCC----------------CCEEEEEECCCHHHCCCCCE
T ss_conf             8730368755443358873230286568----999876522798----------------76288873487112055402


Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             72479982587868999899986089899862578131322899999997317741023478887999989876542117
Q gi|254780270|r  500 DRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKIVKN  579 (820)
Q Consensus       500 drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~~Yt~EaGvR~l~r~i~~i~r~~~~~~~~~  579 (820)
T Consensus       165 SRCQrF~Fk~i~~~~i~---------~~L~~I-~~~E~I~~e~~AL~~IA~~--a~GS~RDAlsllDQ~~~~-------~  225 (363)
T TIGR02397       165 SRCQRFDFKRIPLEDIV---------ERLKKI-LDKEGIKIEDEALELIARA--ADGSMRDALSLLDQAISF-------G  225 (363)
T ss_pred             EECEEECCCCCCHHHHH---------HHHHHH-HHHHCCCCCHHHHHHHHHH--CCCCCCHHHHHHHHHHHH-------C
T ss_conf             10003126789989999---------999999-9870883177899999996--289610688999999982-------6


Q ss_pred             CCCEECCCHHHHHHHHCCC
Q ss_conf             8520127967867530520
Q gi|254780270|r  580 SDTTVSINENNLQDYLGVP  598 (820)
Q Consensus       580 ~~~~~~i~~~~l~~~lg~~  598 (820)
T Consensus       226 ~~~DG~i~~~~v~~~lGl~  244 (363)
T TIGR02397       226 NGSDGKITYEDVNEMLGLV  244 (363)
T ss_pred             CCCCCCCCHHHHHHHHCCC
T ss_conf             8878865789999983577