HHsearch alignment for GI: 254780270 and conserved domain: TIGR02639

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=98.02  E-value=0.00011  Score=54.36  Aligned_cols=295  Identities=24%  Similarity=0.396  Sum_probs=175.5

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC-----------CCEEEEECCCCCCHHHHCCC
Q ss_conf             1168999999999999842444673599860565650279999997708-----------82499861888888883563
Q gi|254780270|r  343 GLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATG-----------RQYVRMSLGGVYDEADIRGH  411 (820)
Q Consensus       343 Gl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~sia~al~-----------r~f~~islgg~~d~~~i~gh  411 (820)
T Consensus       212 GRE~EleRtiQvLC-RR~KNNP-----l~VGEPGVGKTAI~EGLA~~I~~~~kvPe~Lkn~~IY~LDmG~LLAGT-----  280 (774)
T TIGR02639       212 GREDELERTIQVLC-RRKKNNP-----LLVGEPGVGKTAIVEGLAQRIAEGQKVPEVLKNAKIYSLDMGTLLAGT-----  280 (774)
T ss_pred             CCHHHHHHHHHHHC-CCCCCCC-----CEECCCCCCHHHHHHHHHHHHHCCCCCCHHHCCCCEEEECHHHHHHHC-----
T ss_conf             56688742333203-4567887-----204488864489999999986415646700247834540434564102-----


Q ss_pred             CCCCCCCCCHHHHHHHHH-CCCCCE-EEEEECHHHH-HH--HCCC--CHHHHHHH-HCCCCCCCCEEEEECCCCCCCCCE
Q ss_conf             200145671289999983-278873-9999331554-23--1177--11556655-406001681332010352364427
Q gi|254780270|r  412 RRTYIGSMPGRIIQSLKR-AKRSNP-LLLLDEIDKM-GS--DLRG--DPSAALLE-VLDPAQNSSFVDHYLEVEYDLSDV  483 (820)
Q Consensus       412 ~~ty~ga~pg~ii~~l~~-~~~~np-v~~ldeidk~-~~--~~~g--dp~~alle-vldp~qn~~f~d~y~~~~~dls~v  483 (820)
T Consensus       281 --KYRGDFE~RLK~V~~Ei~~~~~anILFIDEIHTIVGAGATSGGsmD-ASNLLKPaL~~-----------------G~i  340 (774)
T TIGR02639       281 --KYRGDFEERLKAVVSEIEKEPNANILFIDEIHTIVGAGATSGGSMD-ASNLLKPALAS-----------------GKI  340 (774)
T ss_pred             --CCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCEEECCCCCCHHHH-HHHHHHHHHHC-----------------CCE
T ss_conf             --4542478999999999852899954664110103317878751552-44321125307-----------------877


Q ss_pred             EEE--EECCC---C-CCCHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH---CC--
Q ss_conf             999--93486---5-5441311724799825878689998999860898998625781313228999999973---17--
Q gi|254780270|r  484 MFI--MTANT---L-NIPLPLMDRMEIIRIAGYTEEEKLQIAKNHLVKKVLTEHALKQEECCISDGVLLDIIR---LF--  552 (820)
Q Consensus       484 ~fi--~tan~---~-~i~~~l~drme~i~~~~y~~~ek~~i~~~~l~p~~~~~~~~~~~~~~~~~~~i~~ii~---~Y--  552 (820)
T Consensus       341 RCIGsTTy~EY~~~FeKDrALsRRFQKIDv~EPs~eet~~ILkG--Lk~~YE~f----H~V~Y~~eal~~Av~LS~ryI~  414 (774)
T TIGR02639       341 RCIGSTTYEEYKNHFEKDRALSRRFQKIDVGEPSIEETVKILKG--LKEQYEEF----HHVKYSDEALEAAVELSARYIN  414 (774)
T ss_pred             EEECCCCHHHHHCHHHCCCCCCCCCCEECCCCCCHHHHHHHHHH--HHHHHHCC----CCEECCHHHHHHHHHHHHHHCC
T ss_conf             86226524864111010202165423311795788899999986--55420132----5011386999999999888602


Q ss_pred             -------------------------C----------------CCCHHHHHHHHHHHHHHHHHHHH--------HC-----
Q ss_conf             -------------------------7----------------41023478887999989876542--------11-----
Q gi|254780270|r  553 -------------------------T----------------HEAGVRSFERALMKIARKAVTKI--------VK-----  578 (820)
Q Consensus       553 -------------------------t----------------~EaGvR~l~r~i~~i~r~~~~~~--------~~-----  578 (820)
T Consensus       415 DRfLPDKAIDviDEaGA~~~l~~~~~~~~~eadekGleetalPev~~~diE~vvak~a~iP~~~~s~ddD~~~L~~L~~~  494 (774)
T TIGR02639       415 DRFLPDKAIDVIDEAGAAFRLRAKAKKKANEADEKGLEETALPEVNVKDIEEVVAKMAKIPVKTVSSDDDREKLKNLEKE  494 (774)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHH
T ss_conf             57898543228899999999712027764320112530004787854449999988718994154264479887204476


Q ss_pred             ---------------------------CCCCEE---------CCC----HHHHHHHHCCC--CCCCCCHHC--------C
Q ss_conf             ---------------------------785201---------279----67867530520--003320002--------2
Q gi|254780270|r  579 ---------------------------NSDTTV---------SIN----ENNLQDYLGVP--RYKYGKIEG--------E  608 (820)
Q Consensus       579 ---------------------------~~~~~~---------~i~----~~~l~~~lg~~--~~~~~~~~~--------~  608 (820)
T Consensus       495 L~~kIfGQD~AI~~lv~aiK~SrAGl~~~nkP~GSFLF~GPTGVGKTElak~LA~~LGv~l~RFDMSEYmEKHTVsRLIG  574 (774)
T TIGR02639       495 LKAKIFGQDEAIEQLVSAIKRSRAGLGEPNKPVGSFLFVGPTGVGKTELAKQLAEELGVHLLRFDMSEYMEKHTVSRLIG  574 (774)
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCHHCCCCCHHHHHHHHHHHHHC
T ss_conf             30131515899999999999987424778881688886479896257889999997082001046504468999987416


Q ss_pred             CCCCCCCEEEECCCC---CEEEEEEEE-EEC-------------------------------CCCC--------EEECCC
Q ss_conf             336500000000016---807999999-974-------------------------------8997--------244325
Q gi|254780270|r  609 DQVGIVTGLAWTEVG---GEILTVEGV-IMP-------------------------------GKGE--------ITITGN  645 (820)
Q Consensus       609 ~~~G~v~GLa~t~~G---G~~l~IE~~-~~~-------------------------------g~g~--------l~lTG~  645 (820)
T Consensus       575 sPPGY--------VGfEqGGLLT-~AvrK~P~cVLLLDEIEKAHpDI~NILLQVMD~AtLTDN~GrKaDFRNVILIMTSN  645 (774)
T TIGR02639       575 SPPGY--------VGFEQGGLLT-DAVRKHPHCVLLLDEIEKAHPDIYNILLQVMDYATLTDNNGRKADFRNVILIMTSN  645 (774)
T ss_pred             CCCCC--------CCCCCCCCCH-HHHCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCEEEECCEEEEECCC
T ss_conf             88885--------1316777212-23312885354234666631336667876633543405888576311368884037


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-------HCCCCHHHHHHCCCEEECC
Q ss_conf             689999999999999999888-------6299855742078147448
Q gi|254780270|r  646 LKEIMKESILAASSYVRSKAT-------TFGIIPSAFNEINIHVHVP  685 (820)
Q Consensus       646 lg~vmkES~~~A~s~~k~~~~-------~~~~~~~~~~~~diHih~p  685 (820)
T Consensus       646 aG--a~E~~~~~iGF~~~~~~~~~~~Aikk~F~PEFRNRLDaii~F~  690 (774)
T TIGR02639       646 AG--AREMSKNPIGFGGERVEDKSEKAIKKLFSPEFRNRLDAIIAFN  690 (774)
T ss_pred             CC--CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECC
T ss_conf             00--1023677644255541233488897315874201334644169