HHsearch alignment for GI: 254780270 and conserved domain: TIGR03608

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=94.69  E-value=0.04  Score=34.93  Aligned_cols=38  Identities=29%  Similarity=0.452  Sum_probs=26.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
T Consensus        22 ~~Ge~~~i~GpSGsGKSTLL~~i~gl~~p~sG~i~~~g   59 (206)
T TIGR03608        22 EKGKMVAIVGESGSGKSTLLNIIGLLEKPDSGQVYLNG   59 (206)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             69989999879997099999999759998975999999