HHsearch alignment for GI: 254780270 and conserved domain: cd01122

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=94.69  E-value=0.075  Score=32.85  Aligned_cols=42  Identities=26%  Similarity=0.323  Sum_probs=31.7

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHH----HHHCCCEEEEECCC
Q ss_conf             4244467359986056565027999999----77088249986188
Q gi|254780270|r  360 RVIKNKGLILCFVGPPGVGKTSLAQSIA----KATGRQYVRMSLGG  401 (820)
Q Consensus       360 ~~~~~~g~il~l~gppgvGKts~~~sia----~al~r~f~~islgg  401 (820)
T Consensus        24 ~~Gl~~GeL~viaarpg~GKT~f~~~~a~~~~~~~g~~vl~~SlEm   69 (271)
T cd01122          24 TKGLRKGELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISLEE   69 (271)
T ss_pred             HCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             3799998089999689986999999999999997699089997049