HHsearch alignment for GI: 254780270 and conserved domain: cd01859

>cd01859 MJ1464 MJ1464. This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=94.89  E-value=0.039  Score=34.96  Aligned_cols=43  Identities=28%  Similarity=0.448  Sum_probs=29.9

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             652011689999999999998424446735998605656502799999
Q gi|254780270|r  339 QDHFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSI  386 (820)
Q Consensus       339 ~~hyGl~~vK~rile~lav~~~~~~~~g~il~l~gppgvGKts~~~si  386 (820)
T Consensus        79 ~~~~g~~~L~~~i~~~~-----~~~~~~~~v~ivG~PNVGKSTLIN~L  121 (156)
T cd01859          79 KERLGTKILRRTIKELA-----KIDGKEGKVGVVGYPNVGKSSIINAL  121 (156)
T ss_pred             CCCCCHHHHHHHHHHHH-----CCCCCCEEEEEECCCCCCHHHHHHHH
T ss_conf             26757999999999860-----23566628999814784598999997