HHsearch alignment for GI: 254780270 and conserved domain: cd03216

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=96.50  E-value=0.01  Score=39.41  Aligned_cols=79  Identities=23%  Similarity=0.294  Sum_probs=49.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC----CCHHHHCCCCCCCCCCCCHHHHH--HHHHCCCCCE-E
Q ss_conf             467359986056565027999999770882499861888----88888356320014567128999--9983278873-9
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGV----YDEADIRGHRRTYIGSMPGRIIQ--SLKRAKRSNP-L  436 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~----~d~~~i~gh~~ty~ga~pg~ii~--~l~~~~~~np-v  436 (820)
T Consensus        24 ~~Gei~~lvG~nGaGKSTl~~~i~Gl~~p~~G~i~i~G~~i~~~~~~~~~~~gi~~v~qLSgG~~Qrv~iaral~~~p~l  103 (163)
T cd03216          24 RRGEVHALLGENGAGKSTLMKILSGLYKPDSGEILVDGKEVSFASPRDARRAGIAMVYQLSVGERQMVEIARALARNARL  103 (163)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCCCEECCCCHHHHHHHHHHHHHHHCCCE
T ss_conf             79989999988998999999999577689857899999999999999999879948946998999999999999729999


Q ss_pred             EEEECH
Q ss_conf             999331
Q gi|254780270|r  437 LLLDEI  442 (820)
Q Consensus       437 ~~ldei  442 (820)
T Consensus       104 lilDEP  109 (163)
T cd03216         104 LILDEP  109 (163)
T ss_pred             EEEECC
T ss_conf             999097