HHsearch alignment for GI: 254780270 and conserved domain: cd03218

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=94.53  E-value=0.051  Score=34.15  Aligned_cols=38  Identities=29%  Similarity=0.441  Sum_probs=30.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
T Consensus        24 ~~Gei~~llGpNGAGKSTll~~i~Gl~~p~~G~I~~~g   61 (232)
T cd03218          24 KQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLDG   61 (232)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             99959999999996199999999779999862999999