HHsearch alignment for GI: 254780270 and conserved domain: cd03235

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=94.72  E-value=0.039  Score=34.96  Aligned_cols=38  Identities=29%  Similarity=0.434  Sum_probs=29.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             46735998605656502799999977088249986188
Q gi|254780270|r  364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGG  401 (820)
Q Consensus       364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg  401 (820)
T Consensus        23 ~~Ge~~~liGpNGaGKSTllk~i~Gl~~p~~G~i~i~g   60 (213)
T cd03235          23 KPGEFLAIVGPNGAGKSTLLKAILGLLKPTSGSIRVFG   60 (213)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECC
T ss_conf             59989999999998699999999768788975899999